[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56004.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  127/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->311 2f8lA PDBj 3e-31 32.7 %
:RPS:PDB   1->311 2ar0A PDBj 7e-13 11.0 %
:RPS:SCOP  4->313 2f8lA1  c.66.1.45 * 1e-28 29.5 %
:HMM:SCOP  2->313 2f8lA1 c.66.1.45 * 6e-36 23.6 %
:RPS:PFM   70->280 PF02384 * N6_Mtase 2e-08 28.4 %
:HMM:PFM   69->282 PF02384 * N6_Mtase 2e-11 24.3 210/311  
:BLT:SWISS 1->311 YTXK_BACSU 5e-42 31.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56004.1 GT:GENE ACF56004.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1859064..1860017) GB:FROM 1859064 GB:TO 1860017 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56004.1 GB:DB_XREF GI:194357556 LENGTH 317 SQ:AASEQ MDFEKIEQAYTYLLENVQVIQSDLATNFYDALVEQNSIYLDGETELEQVKDNNQTLKRLALRKEEWLKTYQFLLMKAGQTEPLQANHQFTPDAIALLLVFIVEELFKEEEITILEMGSGMGILGATFLTSLTKKVDYLGMEVDDLLIDLAASMADVIGLQAGFVQGDAVRPQMLKESDVVISDLPVGYYPDDAVASRHQVASSQEHTYTHHLLMEQGLKYLKSDGYAIFLAPSDLLTSPQSNLLKVWLKEEASLVAMISLPENLFANAKQSKTIFILQKKSEIAVEPFVYPLASLQDASVLMKFKENFQKWTQGTEI GT:EXON 1|1-317:0| BL:SWS:NREP 1 BL:SWS:REP 1->311|YTXK_BACSU|5e-42|31.3|310/329| BL:PDB:NREP 1 BL:PDB:REP 4->311|2f8lA|3e-31|32.7|300/318| RP:PDB:NREP 1 RP:PDB:REP 1->311|2ar0A|7e-13|11.0|310/476| RP:PFM:NREP 1 RP:PFM:REP 70->280|PF02384|2e-08|28.4|208/273|N6_Mtase| HM:PFM:NREP 1 HM:PFM:REP 69->282|PF02384|2e-11|24.3|210/311|N6_Mtase| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF02384|IPR003356| GO:PFM GO:0006306|"GO:DNA methylation"|PF02384|IPR003356| GO:PFM GO:0008170|"GO:N-methyltransferase activity"|PF02384|IPR003356| RP:SCP:NREP 1 RP:SCP:REP 4->313|2f8lA1|1e-28|29.5|302/323|c.66.1.45| HM:SCP:REP 2->313|2f8lA1|6e-36|23.6|305/0|c.66.1.45|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 127 OP:NHOMOORG 127 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111--11111111111111111111-111111111111111111111-11111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 311 STR:RPRED 98.1 SQ:SECSTR ccTTcHHHHHHHHHHHHHHHHTcHHHHccTTccHHHHHTccHHHHHHHHHHHHHHTccccHHHHHccccccHHHHHHHHHHHTccccccccHHHHHHHHHHHccccTTccEEETTcTTTHHHHHHHHHHTTTTTTTTcEEEccHHHHHHHHHHHTTTccccGTccEEEccTTcHHHHTcccEEEEEEccccTTccccccccccccccccHHHHHHHHHHHEEEEEEEEEEEEHHHHHccTHHHHHHHHHHHEEEEEEEEccccccccccccEEEEEEEEcccccTTcccccccEEEEEEccTTcccccccc###### DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHcccccEEEEcccccccccccccEEEEccccccccccHHHHHccccccccccHHHHHHHHHHHHHcccccEEEEEEccccEEcccHHHHHHHHHHcccEEEEEEccccccccccccEEEEEEEccccccccEEEEEccccccHHHHHHHHHHHHHHHHHccc //