[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56005.1
DDBJ      :             Tn5251 hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->57 PF04956 * TrbC 0.00012 28.0 50/100  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56005.1 GT:GENE ACF56005.1 GT:PRODUCT Tn5251 hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1202349..1202570) GB:FROM 1202349 GB:TO 1202570 GB:DIRECTION - GB:PRODUCT Tn5251 hypothetical protein GB:PROTEIN_ID ACF56005.1 GB:DB_XREF GI:194357557 LENGTH 73 SQ:AASEQ MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVKDILLELFNRIIGA GT:EXON 1|1-73:0| TM:NTM 2 TM:REGION 11->32| TM:REGION 44->66| HM:PFM:NREP 1 HM:PFM:REP 5->57|PF04956|0.00012|28.0|50/100|TrbC| OP:NHOMO 21 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1----------1-------2-------------------------1------------111-11-1--------------11---2-1-----------------4----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //