[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56008.1
DDBJ      :             transcriptional activator, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:287 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->224 2qfcA PDBj 1e-13 28.4 %
:RPS:PDB   1->284 2aw6A PDBj 2e-16 13.1 %
:RPS:SCOP  1->67 2aw6A1  a.35.1.11 * 3e-12 28.4 %
:HMM:SCOP  2->62 2awiA1 a.35.1.11 * 7.3e-13 39.3 %
:HMM:PFM   9->61 PF01381 * HTH_3 3e-15 45.3 53/55  
:HMM:PFM   64->108 PF06569 * DUF1128 9.9e-05 31.1 45/71  
:BLT:SWISS 4->64 DNU4_RHORU 2e-06 41.0 %
:BLT:SWISS 58->159 CAPS3_MIMIV 8e-04 36.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56008.1 GT:GENE ACF56008.1 GT:PRODUCT transcriptional activator, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1766952..1767815) GB:FROM 1766952 GB:TO 1767815 GB:DIRECTION - GB:PRODUCT transcriptional activator, putative GB:NOTE identified by match to protein family HMM PF01381 GB:PROTEIN_ID ACF56008.1 GB:DB_XREF GI:194357560 LENGTH 287 SQ:AASEQ MNTLAEKFRLKRKELRLSQQTLAEGICEQSQISKIERGHFIPSADLLFKLSQRLEVPLDYFFNEQIEIKSNLSNFKQLSARLLDDRNYEDLEYIYRIEIERSTFLTLEDRTYLEWIKAIIDFYQYDSKCEAISSLENILLKVSSNTLIYLKALNTLSNFYSLVGREQEYEANYSHLMELYQTKNFEHQXFLFGYIXVRYNYSHYLVSKEKYNEAIQEALETIELCKQRQTSYQLAPLLILVGNAGAKFLDXEQVKNYYIEARELCKIYNNPLMLMKIENYLKELDTV GT:EXON 1|1-287:0| BL:SWS:NREP 2 BL:SWS:REP 4->64|DNU4_RHORU|2e-06|41.0|61/108| BL:SWS:REP 58->159|CAPS3_MIMIV|8e-04|36.0|89/100| BL:PDB:NREP 1 BL:PDB:REP 5->224|2qfcA|1e-13|28.4|204/284| RP:PDB:NREP 1 RP:PDB:REP 1->284|2aw6A|2e-16|13.1|283/287| HM:PFM:NREP 2 HM:PFM:REP 9->61|PF01381|3e-15|45.3|53/55|HTH_3| HM:PFM:REP 64->108|PF06569|9.9e-05|31.1|45/71|DUF1128| RP:SCP:NREP 1 RP:SCP:REP 1->67|2aw6A1|3e-12|28.4|67/69|a.35.1.11| HM:SCP:REP 2->62|2awiA1|7.3e-13|39.3|61/0|a.35.1.11|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 79 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112124231222542-1----221-----3---------2-------------------2------1--111----1---1-------11-----31112112111--------------22--1111------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 99.0 SQ:SECSTR cccHHHHHHHHHHHTTccHHHHHTTTccHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHHHTTcccTTcHHHHHHHHHHHHHHcGGGHHHHHHHHGGGTTTcHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHTTTccHHHHHHHHHGGGccccccccHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHcTTccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHH### DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccc //