[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56026.1
DDBJ      :             alcohol dehydrogenase, zinc-dependent
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  64/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.35.1c.2.1
:340 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->299 2h6eA PDBj 7e-07 20.7 %
:RPS:PDB   7->325 2dfvA PDBj 7e-21 16.0 %
:RPS:SCOP  6->164 1bxzA1  b.35.1.2 * 2e-11 16.3 %
:RPS:SCOP  138->296 1lluA2  c.2.1.1 * 1e-14 20.1 %
:HMM:SCOP  3->174 1pl7A1 b.35.1.2 * 2.8e-24 23.8 %
:HMM:SCOP  136->299 1ykfA2 c.2.1.1 * 1.4e-11 25.5 %
:RPS:PFM   29->132 PF08240 * ADH_N 3e-04 27.0 %
:HMM:PFM   27->131 PF08240 * ADH_N 2.6e-13 28.4 102/109  
:HMM:PFM   221->295 PF00107 * ADH_zinc_N 6.7e-09 23.6 72/130  
:BLT:SWISS 1->340 TARJ_BACSU 3e-77 41.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56026.1 GT:GENE ACF56026.1 GT:PRODUCT alcohol dehydrogenase, zinc-dependent GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1137380..1138402) GB:FROM 1137380 GB:TO 1138402 GB:DIRECTION - GB:PRODUCT alcohol dehydrogenase, zinc-dependent GB:NOTE identified by match to protein family HMM PF08240 GB:PROTEIN_ID ACF56026.1 GB:DB_XREF GI:194357578 LENGTH 340 SQ:AASEQ MINQIYQLTKPKXINVKYQEEAIDQENHILIRPNYMAVCXADQRYYQGKRDPKILNKKLPMAMIHESCGTVISDPTGTYEVGQKVVMIPNQSPMQSDEEFYENYMTGTHFLSSGFDGFMREFVSLPKDRVVAYDAIEDTVAAITEFVSVGMHAMNRLLTLAHSKRERIAVIGDGSLAFVVANIINYTLPESEIVVIGRHWEKLELFSFAKECYITDNIPEDLAFDHAFECCGGDGTGPAINDLIRYIRPQGTILMMGVSEYKVNLNTRDALEKGLILVGSSRSGRIDFENAIQMMEVKKFANRLKNILYLEEPVREIKDIHRVFATDLNTAFKTVFKWEV GT:EXON 1|1-340:0| BL:SWS:NREP 1 BL:SWS:REP 1->340|TARJ_BACSU|3e-77|41.4|338/341| BL:PDB:NREP 1 BL:PDB:REP 25->299|2h6eA|7e-07|20.7|271/323| RP:PDB:NREP 1 RP:PDB:REP 7->325|2dfvA|7e-21|16.0|307/340| RP:PFM:NREP 1 RP:PFM:REP 29->132|PF08240|3e-04|27.0|100/108|ADH_N| HM:PFM:NREP 2 HM:PFM:REP 27->131|PF08240|2.6e-13|28.4|102/109|ADH_N| HM:PFM:REP 221->295|PF00107|6.7e-09|23.6|72/130|ADH_zinc_N| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08240|IPR013154| RP:SCP:NREP 2 RP:SCP:REP 6->164|1bxzA1|2e-11|16.3|153/178|b.35.1.2| RP:SCP:REP 138->296|1lluA2|1e-14|20.1|154/166|c.2.1.1| HM:SCP:REP 3->174|1pl7A1|2.8e-24|23.8|168/186|b.35.1.2|1/1|GroES-like| HM:SCP:REP 136->299|1ykfA2|1.4e-11|25.5|157/0|c.2.1.1|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 83 OP:NHOMOORG 68 OP:PATTERN --------------------------------1----------------------------------- -------------------------------------11------------------------------------------1-------------------------------------------------------11----------------------------------------------------------------------1-11----------1-111111-1-22222212222222-11-2-----1-----11-----1-----------------11111111111-----------------------1-------------1----------------------------11-------------------------------------------------------111---11--------------------------------------------------------------------------1------------------------1--------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------1---1--1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ----------------------------------------------------1-----------------------2--1----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 334 STR:RPRED 98.2 SQ:SECSTR #####EEEcccccEccEEEEEEcccTTEEEEEEEEEEccHHHHHHHHTcccHHHHHHccccEEccEEEEEEEEEcTTcccTTcEEEEccEEcccccHHHHTGGGcTTcEETTTTcccccccEEEEEGGGEEccTTccHHHHTTHHHHHHHHHHHTTHHHHcccTTccEEEEcccHHHHHHHHHHHHHTTcccEEEEcccHHHHHHHHHHTccEEEcTTTccHHEEEEEEccccHHHTHHHHHHHHHEEEEEEEEEccccccccccHHHHTTTTTcEEEEcccccTHHHHHHHHHHHTTccHccTTTEEEEEEccTTHHHHHHHHTTccTcccEEEEcTT# DISOP:02AL 1-1| PSIPRED cccEEEEEEcccEEEEEEEccccccccEEEEEEEEEEEEHHHHHHHccccccccccccccEEcccccEEEEEcccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEEcHHHEEEcccccHHHHccccHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEcccccccEEEEEEEcccccccHHHHHHHHHHHccccEEEEEccccccccccHHHHHHccEEEEEEEcccHHHHHHHHHHHHccccccccEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEEEc //