[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56031.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:392 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   169->212 PF10408 * Ufd2P_core 7e-04 40.9 %
:HMM:PFM   290->320 PF10180 * DUF2373 0.00095 64.3 28/65  
:BLT:SWISS 182->349 RPOB_SACEN 3e-05 26.0 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56031.1 GT:GENE ACF56031.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1017266..1018444 GB:FROM 1017266 GB:TO 1018444 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56031.1 GB:DB_XREF GI:194357583 LENGTH 392 SQ:AASEQ MTLPVRKSLHDAVLQASKADTWEQATKEWNEVSLMFNGIGRSNCVCGNAIKYAYELFNGVTGQRLFPIGSDCVRHFHRLSLDQQLEEEEKLLRKVENLTRKAQKKEKIKVNKSDFDERLLKWLWEKGVFKPNRGNQFAPERDYQLFLEVFQGGSWTKAEPKKKARMEEVLEKCIKPFLLGKSDDQLYLVKLGKEKIDYEQELRIQAEKERKKRDKIAKQYADNLVLAMGPAERAYQDYFGFTETLTQEERKWEKILFGKNRAERAIKAKQYQKELEKDQRIASQDPIERKQKQTWLLNSYFRELPEEKARFSRLLLEYRKSGEVPFSTEYLSDHLIDFFYKMKAFEFEIAPEQVRDFLKKSLQEDHRSSAQGSWIEGILLNCLKPFLGRLVI GT:EXON 1|1-392:0| BL:SWS:NREP 1 BL:SWS:REP 182->349|RPOB_SACEN|3e-05|26.0|150/1164| COIL:NAA 31 COIL:NSEG 1 COIL:REGION 77->107| TM:NTM 1 TM:REGION 372->392| SEG 78->96|rlsldqqleeeekllrkve| RP:PFM:NREP 1 RP:PFM:REP 169->212|PF10408|7e-04|40.9|44/614|Ufd2P_core| HM:PFM:NREP 1 HM:PFM:REP 290->320|PF10180|0.00095|64.3|28/65|DUF2373| GO:PFM:NREP 5 GO:PFM GO:0000151|"GO:ubiquitin ligase complex"|PF10408|IPR019474| GO:PFM GO:0005515|"GO:protein binding"|PF10408|IPR019474| GO:PFM GO:0006511|"GO:ubiquitin-dependent protein catabolic process"|PF10408|IPR019474| GO:PFM GO:0016567|"GO:protein ubiquitination"|PF10408|IPR019474| GO:PFM GO:0034450|"GO:ubiquitin-ubiquitin ligase activity"|PF10408|IPR019474| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,157-165,202-218,267-288,363-372| PSIPRED cccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHEEccccccccccHHHHHHHHHHHccccccEEccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccHHccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHEEccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcc //