[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56035.1
DDBJ      :             5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase
Swiss-Prot:FOLD_STRR6   RecName: Full=Bifunctional protein folD;Includes:  RecName: Full=Methylenetetrahydrofolate dehydrogenase;           EC=1.5.1.5;Includes:  RecName: Full=Methenyltetrahydrofolate cyclohydrolase;           EC=3.5.4.9;

Homologs  Archaea  27/68 : Bacteria  887/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:292 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->290 1b0aA PDBj 2e-69 52.6 %
:RPS:PDB   10->289 1b0aA PDBj 2e-49 48.2 %
:RPS:SCOP  10->153 1edzA2  c.58.1.2 * 2e-34 17.7 %
:RPS:SCOP  129->290 1a4iA1  c.2.1.7 * 9e-22 50.6 %
:HMM:SCOP  7->128 1a4iA2 c.58.1.2 * 1.8e-42 58.2 %
:HMM:SCOP  129->294 1b0aA1 c.2.1.7 * 2.4e-53 41.6 %
:RPS:PFM   27->127 PF00763 * THF_DHG_CYH 1e-29 65.3 %
:RPS:PFM   131->287 PF02882 * THF_DHG_CYH_C 1e-56 65.6 %
:HMM:PFM   130->287 PF02882 * THF_DHG_CYH_C 8.8e-74 60.8 158/161  
:HMM:PFM   10->127 PF00763 * THF_DHG_CYH 5.7e-46 60.7 117/117  
:BLT:SWISS 8->292 FOLD_STRR6 e-153 99.6 %
:PROS 82->107|PS00766|THF_DHG_CYH_1
:PROS 266->274|PS00767|THF_DHG_CYH_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56035.1 GT:GENE ACF56035.1 GT:PRODUCT 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 727007..727885 GB:FROM 727007 GB:TO 727885 GB:DIRECTION + GB:PRODUCT 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase GB:NOTE identified by match to protein family HMM PF00763; match to protein family HMM PF02882 GB:PROTEIN_ID ACF56035.1 GB:DB_XREF GI:194357587 LENGTH 292 SQ:AASEQ MKEKRSDMTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAAGSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVDGFHPLNMGRLWSGHPVMIPSTPAGIMEMFHEYGIDLEGKNAVVIGRSNIVGKPMAQLLLAKNATVTLAHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDENGKLCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK GT:EXON 1|1-292:0| SW:ID FOLD_STRR6 SW:DE RecName: Full=Bifunctional protein folD;Includes: RecName: Full=Methylenetetrahydrofolate dehydrogenase; EC=1.5.1.5;Includes: RecName: Full=Methenyltetrahydrofolate cyclohydrolase; EC=3.5.4.9; SW:GN Name=folD; OrderedLocusNames=spr0729; SW:KW Amino-acid biosynthesis; Complete proteome; Histidine biosynthesis;Hydrolase; Methionine biosynthesis; Multifunctional enzyme; NADP;One-carbon metabolism; Oxidoreductase; Purine biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 8->292|FOLD_STRR6|e-153|99.6|285/285| GO:SWS:NREP 9 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009086|"GO:methionine biosynthetic process"|Methionine biosynthesis| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| PROS 82->107|PS00766|THF_DHG_CYH_1|PDOC00616| PROS 266->274|PS00767|THF_DHG_CYH_2|PDOC00616| SEG 14->26|gkalaaklqgqla| BL:PDB:NREP 1 BL:PDB:REP 40->290|1b0aA|2e-69|52.6|251/287| RP:PDB:NREP 1 RP:PDB:REP 10->289|1b0aA|2e-49|48.2|280/287| RP:PFM:NREP 2 RP:PFM:REP 27->127|PF00763|1e-29|65.3|101/118|THF_DHG_CYH| RP:PFM:REP 131->287|PF02882|1e-56|65.6|157/160|THF_DHG_CYH_C| HM:PFM:NREP 2 HM:PFM:REP 130->287|PF02882|8.8e-74|60.8|158/161|THF_DHG_CYH_C| HM:PFM:REP 10->127|PF00763|5.7e-46|60.7|117/117|THF_DHG_CYH| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF00763|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF00763|IPR000672| GO:PFM GO:0003824|"GO:catalytic activity"|PF02882|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF02882|IPR000672| RP:SCP:NREP 2 RP:SCP:REP 10->153|1edzA2|2e-34|17.7|141/146|c.58.1.2| RP:SCP:REP 129->290|1a4iA1|9e-22|50.6|158/160|c.2.1.7| HM:SCP:REP 7->128|1a4iA2|1.8e-42|58.2|122/125|c.58.1.2|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 129->294|1b0aA1|2.4e-53|41.6|166/166|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1576 OP:NHOMOORG 1100 OP:PATTERN ------------------11111-21111111-----------11-1111111--------111--11 1111211111111111111-11111111111111111222122111111111221111112221222211111111111112311111111111111--1111111111111111111111111111111111111111111121111111111111111111111111111111111111112211111121111111111111111111111111111111111111111211111111111111111111111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111211111111111111111111111111111111111111111111111-1-------1211311122211322111111121111313111111111111-11111111111111111111111111111111112311112211111111111111121111111111111111112111111111111111111111-1111111111111111111111111212122111111121111111111111111111111111111111111112111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111121111111111111112111111111111332211122211111111121111111111111111111111111111111111111111111111111----1-111-111---111111---1111111111111 ----332-311-12211-1-111111111111111111111111111222221111111111333333233232333-3333333233-111111111112-1324-16245747643342443764F2Ld5-8563442624554432353364553333223242633D21121333Y2222163641431144432 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 97.6 SQ:SECSTR #####ccccEEccHHHHHHHHHHHHHHHHHHHHHTTccccEEEEEEEcccHHHHHHHHHHHHHHHHHTcEEccEEEcTTccHHHHHHHHHHHHTcTTccEEEEcccccTTccHHHHHTTccTTTcTTcccHHHHHHHHTTccccccHHHHHHHHHHHHTTcccTTcEEEEEcccTTTHHHHHHHHHTTTcEEEEEccccccHHHHHHHccEEEEccccTTcccTTTccTTcEEEEcccEEcTTccEEccccHHHHHHHccEEcccccccHHHHHHHHHHHHHHHHHHTTc## DISOP:02AL 1-6,8-9,291-293| PSIPRED cccccccHHEEEccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHccHHHccccccHHHHHHHHccccccccccHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHcccEEEEEEccccHHHHHHHHccEEEEEccccccccHHHcccccEEEEccccccccccEEEEccHHHHHHHccEEcccccccHHHHHHHHHHHHHHHHHHHHHcc //