[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56049.1
DDBJ      :             ribosome-binding factor A
Swiss-Prot:RBFA_STRZT   RecName: Full=Ribosome-binding factor A;

Homologs  Archaea  0/68 : Bacteria  535/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.52.7
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->103 1josA PDBj 6e-17 39.8 %
:RPS:PDB   1->115 2e7gA PDBj 1e-28 17.5 %
:RPS:SCOP  3->114 2e7gA1  d.52.7.1 * 7e-32 18.0 %
:HMM:SCOP  1->105 1kkgA_ d.52.7.1 * 2e-27 40.0 %
:RPS:PFM   9->110 PF02033 * RBFA 2e-21 49.5 %
:HMM:PFM   6->110 PF02033 * RBFA 7.7e-34 42.3 104/104  
:BLT:SWISS 1->116 RBFA_STRZT 2e-62 100.0 %
:PROS 76->97|PS01319|RBFA

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56049.1 GT:GENE ACF56049.1 GT:PRODUCT ribosome-binding factor A GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 489993..490343 GB:FROM 489993 GB:TO 490343 GB:DIRECTION + GB:PRODUCT ribosome-binding factor A GB:NOTE identified by match to protein family HMM PF02033; match to protein family HMM TIGR00082 GB:PROTEIN_ID ACF56049.1 GB:DB_XREF GI:194357601 LENGTH 116 SQ:AASEQ MANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNLDKN GT:EXON 1|1-116:0| SW:ID RBFA_STRZT SW:DE RecName: Full=Ribosome-binding factor A; SW:GN Name=rbfA; OrderedLocusNames=SPT_0587; SW:KW Complete proteome; Cytoplasm; rRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->116|RBFA_STRZT|2e-62|100.0|116/116| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| PROS 76->97|PS01319|RBFA|PDOC01023| BL:PDB:NREP 1 BL:PDB:REP 6->103|1josA|6e-17|39.8|98/100| RP:PDB:NREP 1 RP:PDB:REP 1->115|2e7gA|1e-28|17.5|114/129| RP:PFM:NREP 1 RP:PFM:REP 9->110|PF02033|2e-21|49.5|101/104|RBFA| HM:PFM:NREP 1 HM:PFM:REP 6->110|PF02033|7.7e-34|42.3|104/104|RBFA| GO:PFM:NREP 1 GO:PFM GO:0006364|"GO:rRNA processing"|PF02033|IPR000238| RP:SCP:NREP 1 RP:SCP:REP 3->114|2e7gA1|7e-32|18.0|111/116|d.52.7.1| HM:SCP:REP 1->105|1kkgA_|2e-27|40.0|105/0|d.52.7.1|1/1|Ribosome-binding factor A, RbfA| OP:NHOMO 543 OP:NHOMOORG 541 OP:PATTERN -------------------------------------------------------------------- ----1-1------1--------111------1-------1--1-111-111-1111-1--1-1111-11-11111111------------------------------1---------------1-1---------11111---1-1111--11111111-1111111111-111---1-11------11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11----------------------------------------------------------------------------------------------------------------------------------1111111----111-------11111-1-----1----11-11-1111-11111111111111111-11111----1----11111111111111-11---------------------------111111111111----11------------1-111111-111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111-11111111111--111111111111111111111111111111-11-1111111111111111111111111-1-11------------1-11111------------------111------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-113----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 99.1 SQ:SECSTR cHHHHHHHHHHHHHHHHHHHHTTcTTTcHHHHHccEEEEEEcTTcccEEEEEccccccHHHHHHHHHHHHHTHHHHHHHHHTcTTccccccEEEEETTccccccccccccccccc# DISOP:02AL 1-4,8-8,115-117| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEccEEEEEEccHHHHHHHHHHHHHHHHcc //