[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56057.1
DDBJ      :             acetyltransferase, GNAT family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:143 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   19->141 2r7hA PDBj 9e-06 29.2 %
:RPS:PDB   1->131 3dr8A PDBj 4e-15 22.0 %
:RPS:SCOP  2->141 1s3zA  d.108.1.1 * 9e-15 12.9 %
:HMM:SCOP  1->139 2b5gA1 d.108.1.1 * 2.7e-24 26.6 %
:RPS:PFM   76->130 PF00583 * Acetyltransf_1 6e-06 40.0 %
:HMM:PFM   72->131 PF00583 * Acetyltransf_1 6.3e-17 38.3 60/83  
:BLT:SWISS 35->133 YHDJ_BACSU 2e-06 31.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56057.1 GT:GENE ACF56057.1 GT:PRODUCT acetyltransferase, GNAT family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 912044..912475 GB:FROM 912044 GB:TO 912475 GB:DIRECTION + GB:PRODUCT acetyltransferase, GNAT family GB:NOTE identified by match to protein family HMM PF00583 GB:PROTEIN_ID ACF56057.1 GB:DB_XREF GI:194357609 LENGTH 143 SQ:AASEQ MLRDLQETDVKAICDINQEALGYTFSPEETASQLARLSQDSHHFLLGYEDAANHVLLGYVHAEVYESLYSKAGFNILALAVSPQAQGEGIGKSLLQGLEQEAKRCGYGFIRLNSANHRLGAHAFYEKVGYTCDKMQKRFIRIF GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 35->133|YHDJ_BACSU|2e-06|31.2|96/142| BL:PDB:NREP 1 BL:PDB:REP 19->141|2r7hA|9e-06|29.2|113/155| RP:PDB:NREP 1 RP:PDB:REP 1->131|3dr8A|4e-15|22.0|127/169| RP:PFM:NREP 1 RP:PFM:REP 76->130|PF00583|6e-06|40.0|55/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 72->131|PF00583|6.3e-17|38.3|60/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 2->141|1s3zA|9e-15|12.9|139/147|d.108.1.1| HM:SCP:REP 1->139|2b5gA1|2.7e-24|26.6|139/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------------------------------------------------1----------------------------1-------------------1--111---11111--111111111111111111111111111---1111------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------1---------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 100.0 SQ:SECSTR EEEEccGGGHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHTccEEEEEETTTTTEEEEEEEEEEccccGGGTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTcTccEEEEEETTcHHHHHHHHHTTcEEEEEEEEEcccc PSIPRED ccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccEEEEEEEcccEEEEEEEEEEEccccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHcccEEEEEEEEEEEcc //