[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56062.1
DDBJ      :             beta-glucosidase
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  379/915 : Eukaryota  125/199 : Viruses  0/175   --->[See Alignment]
c.1.8
:471 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->465 1uyqA PDBj 3e-64 36.0 %
:RPS:PDB   4->464 1e4nA PDBj e-119 31.5 %
:RPS:SCOP  1->469 1gowA  c.1.8.4 * 1e-70 23.1 %
:HMM:SCOP  2->469 1qvbA_ c.1.8.4 * 3.3e-165 48.3 %
:RPS:PFM   4->465 PF00232 * Glyco_hydro_1 e-116 51.6 %
:HMM:PFM   3->466 PF00232 * Glyco_hydro_1 1.2e-135 41.8 445/455  
:BLT:SWISS 4->469 ABGA_CLOLO 0.0 64.7 %
:PROS 360->368|PS00572|GLYCOSYL_HYDROL_F1_1
:PROS 8->22|PS00653|GLYCOSYL_HYDROL_F1_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56062.1 GT:GENE ACF56062.1 GT:PRODUCT beta-glucosidase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 507319..508734 GB:FROM 507319 GB:TO 508734 GB:DIRECTION + GB:PRODUCT beta-glucosidase GB:NOTE identified by match to protein family HMM PF00232 GB:PROTEIN_ID ACF56062.1 GB:DB_XREF GI:194357614 LENGTH 471 SQ:AASEQ MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEATENPTEDNLKLLGIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEXEPNEAGLKYYDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKVKYWLTFNEVNSVLELPFTSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEFKVGCMVLAMPAYPMTPNPKDVWATHEYENLNXLFSDVHVRGYYPNYAKRYFKEHDINIEFAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQIDPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMKEHLLQVAEALQDGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWYKGVIESNGESLFK GT:EXON 1|1-471:0| BL:SWS:NREP 1 BL:SWS:REP 4->469|ABGA_CLOLO|0.0|64.7|465/473| PROS 360->368|PS00572|GLYCOSYL_HYDROL_F1_1|PDOC00495| PROS 8->22|PS00653|GLYCOSYL_HYDROL_F1_2|PDOC00495| BL:PDB:NREP 1 BL:PDB:REP 4->465|1uyqA|3e-64|36.0|433/447| RP:PDB:NREP 1 RP:PDB:REP 4->464|1e4nA|e-119|31.5|448/489| RP:PFM:NREP 1 RP:PFM:REP 4->465|PF00232|e-116|51.6|440/450|Glyco_hydro_1| HM:PFM:NREP 1 HM:PFM:REP 3->466|PF00232|1.2e-135|41.8|445/455|Glyco_hydro_1| GO:PFM:NREP 2 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF00232|IPR001360| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00232|IPR001360| RP:SCP:NREP 1 RP:SCP:REP 1->469|1gowA|1e-70|23.1|433/489|c.1.8.4| HM:SCP:REP 2->469|1qvbA_|3.3e-165|48.3|429/0|c.1.8.4|1/1|(Trans)glycosidases| OP:NHOMO 1855 OP:NHOMOORG 524 OP:PATTERN --1-1--11111111--31-----------------------------------142-2-3111---- -11-3----121211------1---1----------12111--321--242-243-----23213-3357221111--1---1------------------1---111-1--------------------------12212---211--1-------------------1-------------11-1122-115-----1-11--1---3466741-1-33-2179AAB9A-1-2222222222222211113781-561-716BB--882-5534689223833454477666675736444444444444445566-544C1--7B222321311119---1121-22-111--------2---1321--3-1-311--------322---1-111----------1-------------111211111111-----11-111111--------------2---------------------------------2-1------111--1-------11--------1---------1-------2---------1------------------1-----------------------24-----------------------------1161-21---11111111--------1--1-------------3675-813223344444-23343234342422333348A89A12-212222222222222252211233--611111111111-------------1-1-1---1-------------------------1------------------------11211111121211-----------------1--------------1------9-----2------12------2212112-11--- -1-------------42223553333311-----------------3322355642211111----------1----------------242223--1-1--------71S677B6B4455445552657H5-55754456345545455533B5555635P-575I16AD222--11--11127DVig3sL11EHGJ1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 471 STR:RPRED 100.0 SQ:SECSTR cEEccTTcEEEEEccHHHHcccTTcTTccccHHHHHHHHcGGGcTTccccccTTTcTTcHHHHHHHHHHHHHHHTccEEEEEccHHHHcTTccTTcccHHHHHHHHHHHHHHHHTTcEEEEEEEcccccHHHHHHHcGGGccHHHHHHHHHHHHHHHHHTTTccEEEEEEcHHHHHHHHHTcccccccTTccTTTHHHHHHHHHHHHHHHHHHHHHHccTTcEEEEEEEEEEEEEccccHHHHHHHHHHHHHTHHHHHHHHHccccHHHHHHHGGGcccccccHHHHHHHTTccccEEEEEEEEEEEEEEcccGcEEEEcccTTcccccccccccccccccHHHHHHHHHHHHHTccccEEEEEccccEEccccccccHHHHHccHHHHHHHHHHHHHHHHHHHTTccEEEEEEEcccccccGGGTTTcEEcccEEEETTTcccTTTEEEEcHHHHHHHHHHHcTEEEccc DISOP:02AL 1-1,467-472| PSIPRED ccccccccEEEEEccHHHHccccccccccccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccHHHcccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEcccccHHHHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHccccccccHHHHHHHHcccEEEEEEcccccEEEEcccccccccccccccccccccccccccccEEccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccEEEEEEEEEEEEccccccccccEEEcHHHHHHHHHHHHccccccc //