[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56070.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  540/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
c.1.16d.43.2
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   57->198 3bk6B PDBj 1e-18 28.6 %
:RPS:SCOP  63->188 1winA  d.43.2.1 * 2e-18 18.3 %
:RPS:SCOP  187->296 1tvlA  c.1.16.4 * 6e-04 21.0 %
:HMM:SCOP  53->189 1winA_ d.43.2.1 * 5.9e-25 35.3 %
:RPS:PFM   33->197 PF01145 * Band_7 6e-16 35.6 %
:HMM:PFM   25->198 PF01145 * Band_7 7.9e-34 30.0 170/179  
:BLT:SWISS 129->294 PLZ12_LUPPO 3e-32 42.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56070.1 GT:GENE ACF56070.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1983788..1984687) GB:FROM 1983788 GB:TO 1984687 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01145 GB:PROTEIN_ID ACF56070.1 GB:DB_XREF GI:194357622 LENGTH 299 SQ:AASEQ MAIFFMIFLIVCVLLLVIVTLSTVYVVRQQSVAIIERFGKYQKVANSGIHIRLPFGIDSIAARIQLRLLQSDIVVETKTKDNVFVMMNVATQYRVNEQSVTDAYYKLIRPESQIKSYIEDALRSSVPKLTLDELFEKKDEIALEVQHQVAEEMTTYGYIIVKTLITKVEPDAEVKQSMNEINAAQRKRVAAQELAEADKIKIVTAAEAEAEKDRLHGVGIAQQRKAIVDGLAESITELKEANVGMTEEQIMSILLTNQYLDTLNTFASKGNQTIFLPNTPNGVDDIRTQILSALRAEKK GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 129->294|PLZ12_LUPPO|3e-32|42.8|166/184| TM:NTM 1 TM:REGION 3->25| SEG 9->27|livcvlllvivtlstvyvv| RP:PDB:NREP 1 RP:PDB:REP 57->198|3bk6B|1e-18|28.6|140/142| RP:PFM:NREP 1 RP:PFM:REP 33->197|PF01145|6e-16|35.6|163/183|Band_7| HM:PFM:NREP 1 HM:PFM:REP 25->198|PF01145|7.9e-34|30.0|170/179|Band_7| RP:SCP:NREP 2 RP:SCP:REP 63->188|1winA|2e-18|18.3|126/143|d.43.2.1| RP:SCP:REP 187->296|1tvlA|6e-04|21.0|100/390|c.1.16.4| HM:SCP:REP 53->189|1winA_|5.9e-25|35.3|133/0|d.43.2.1|1/1|Band 7/SPFH domain| OP:NHOMO 854 OP:NHOMOORG 682 OP:PATTERN ------------------------11111-21--1--211111-----------1-1111-------- ----111111111111111-11--1111111-1111111111--11111--1111111--111-11112211111111-1111-1---------11---11111111121---------------1--------1-----------122121-11------1-11-11121-------1----1-1----1---111111111111111------111-----11-------1------------------------11-1---11--111--111111111111111111111111111122211111111111112-11111--111111122121-111111111-----1-------11------1--1---111---------1112------1111111-111---1-----1---111111111111-11-1-111111111-------------1------------111111111111111-----1--1-222221111112222211112222211111111--11111111111111111-1111111111-1----1111--111-11111-----1--11112111--111--1-------1--------1--111--1--11111122222223222222332321-----1------1111-111111111111-111111111111111111111111111111-1111111111-1111111111-111111111111--11-----131122--2---1-1-----1--11111111111------11-1---------1----1----111-111111111111111111111111---1112222--------1-1-------------------------1312222222--- 11--211-42--11211-1-111111111111111111111-11-11---1111-111-1111-1--------1-------------1----1----------11--112118111----11--11111121-111---111111-1--1-1-11-1-1---1111111---1-21232P1113347DA1924411114 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 59.5 SQ:SECSTR ########################################################ccccccccccccEEEEEEEEEEcTTccEEEEEEEEEEEEccHHHHHHHHccccHHHHHHHHHHHHHHHHHHTccHHHHHHcHHHHHHHHHHHHHHHTGGGTEEEEEEEEEEEEccTTHHHHHHHHHHHHHHHHTTTTTccccHHHHcHHHHHHHHHHHHHcTTHHHHHHTHHHHHHHH################################################################# DISOP:02AL 266-267,296-300| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHEEEccccEEEEEEEccEEEEEEcccEEEEEcccEEEEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEccHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHccc //