[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56082.1
DDBJ      :             conserved hypothetical protein, degenerate
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.1
:72 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->49 3bvsA PDBj 3e-08 41.7 %
:RPS:SCOP  1->49 2b6cA1  a.118.1.17 * 6e-11 24.5 %
:HMM:PFM   2->55 PF08713 * DNA_alkylation 2.3e-11 37.0 54/213  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56082.1 GT:GENE ACF56082.1 GT:PRODUCT conserved hypothetical protein, degenerate GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 347696..347914 GB:FROM 347696 GB:TO 347914 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein, degenerate GB:PROTEIN_ID ACF56082.1 GB:DB_XREF GI:194357634 LENGTH 72 SQ:AASEQ MAANYLKAMQSYLKETDLPKLEQLVVTKSWWDTVDILDRVVGSLVYEHPELEEIILILFENLFKPRQLYLQP GT:EXON 1|1-72:0| SEG 50->58|eleeiilil| BL:PDB:NREP 1 BL:PDB:REP 2->49|3bvsA|3e-08|41.7|48/227| HM:PFM:NREP 1 HM:PFM:REP 2->55|PF08713|2.3e-11|37.0|54/213|DNA_alkylation| RP:SCP:NREP 1 RP:SCP:REP 1->49|2b6cA1|6e-11|24.5|49/213|a.118.1.17| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-11-1--1--------------1----------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 66.7 SQ:SECSTR #HHHHHHHTGGGccGGGHHHHHHHHHccccHHHHTTTTTHHHHHHHHcG####################### DISOP:02AL 71-73| PSIPRED ccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHccc //