[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56084.1
DDBJ      :             CAAX amino terminal protease family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   123->219 PF02517 * Abi 3e-21 35.4 96/99  
:HMM:PFM   30->105 PF04657 * DUF606 7.2e-05 19.2 73/138  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56084.1 GT:GENE ACF56084.1 GT:PRODUCT CAAX amino terminal protease family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 172391..173068 GB:FROM 172391 GB:TO 173068 GB:DIRECTION + GB:PRODUCT CAAX amino terminal protease family GB:NOTE identified by match to protein family HMM PF02517 GB:PROTEIN_ID ACF56084.1 GB:DB_XREF GI:194357636 LENGTH 225 SQ:AASEQ MMSNKNKGILIFAILYTVLFVFDGVKLLASLMPSAIANYLVYVVLALYGSFLFKDRLIQQWKGIRKTKRKFFFGVLTGWLFLILMTVVFEFVSEMLKQFVGLDGQGLNQSNIQSTFQEQPLLIAVFACVIGPLVEELFFRQVLLHYLQERLSGLLSIILVGLVFALTHMHSLALSEWIGAVGYLGGGLAFSIIYVKEKENIYYPLXVHMLSNSLSLIILAISIVK GT:EXON 1|1-225:0| TM:NTM 7 TM:REGION 9->31| TM:REGION 33->54| TM:REGION 71->93| TM:REGION 118->140| TM:REGION 148->170| TM:REGION 174->196| TM:REGION 204->225| SEG 151->163|lsgllsiilvglv| SEG 210->223|lsnslsliilaisi| HM:PFM:NREP 2 HM:PFM:REP 123->219|PF02517|3e-21|35.4|96/99|Abi| HM:PFM:REP 30->105|PF04657|7.2e-05|19.2|73/138|DUF606| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------1--11111111111-------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-8,103-111| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHc //