[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56087.1
DDBJ      :             ribosome small subunit-dependent GTPase A
Swiss-Prot:RSGA_STRR6   RecName: Full=Putative ribosome biogenesis GTPase rsgA;         EC=3.6.1.-;

Homologs  Archaea  5/68 : Bacteria  703/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
b.40.4c.37.1
:292 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->283 1t9hA PDBj 2e-69 52.1 %
:RPS:PDB   86->212 3d5aX PDBj 9e-23 22.0 %
:RPS:SCOP  1->62 1u0lA1  b.40.4.5 * 6e-13 29.0 %
:RPS:SCOP  63->283 1t9hA2  c.37.1.8 * 2e-12 38.7 %
:HMM:SCOP  1->62 1t9hA1 b.40.4.5 * 3.7e-18 41.9 %
:HMM:SCOP  63->283 1t9hA2 c.37.1.8 * 1.6e-55 38.9 %
:RPS:PFM   127->273 PF03193 * DUF258 7e-43 58.5 %
:HMM:PFM   139->273 PF03193 * DUF258 3.6e-53 51.9 135/161  
:BLT:SWISS 1->292 RSGA_STRR6 e-169 99.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56087.1 GT:GENE ACF56087.1 GT:PRODUCT ribosome small subunit-dependent GTPase A GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1798143..1799021) GB:FROM 1798143 GB:TO 1799021 GB:DIRECTION - GB:PRODUCT ribosome small subunit-dependent GTPase A GB:NOTE identified by match to protein family HMM PF03193; match to protein family HMM TIGR00157 GB:PROTEIN_ID ACF56087.1 GB:DB_XREF GI:194357639 LENGTH 292 SQ:AASEQ MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPIVNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYRQTYGDIGYDFVTSKEELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGFSSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRRETYKKVSKKIPK GT:EXON 1|1-292:0| SW:ID RSGA_STRR6 SW:DE RecName: Full=Putative ribosome biogenesis GTPase rsgA; EC=3.6.1.-; SW:GN Name=rsgA; OrderedLocusNames=spr1798; SW:KW Complete proteome; GTP-binding; Hydrolase; Metal-binding;Nucleotide-binding; Zinc. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->292|RSGA_STRR6|e-169|99.0|292/292| GO:SWS:NREP 4 GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| BL:PDB:NREP 1 BL:PDB:REP 2->283|1t9hA|2e-69|52.1|263/287| RP:PDB:NREP 1 RP:PDB:REP 86->212|3d5aX|9e-23|22.0|123/354| RP:PFM:NREP 1 RP:PFM:REP 127->273|PF03193|7e-43|58.5|147/160|DUF258| HM:PFM:NREP 1 HM:PFM:REP 139->273|PF03193|3.6e-53|51.9|135/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0003924|"GO:GTPase activity"|PF03193|IPR004881| GO:PFM GO:0005525|"GO:GTP binding"|PF03193|IPR004881| RP:SCP:NREP 2 RP:SCP:REP 1->62|1u0lA1|6e-13|29.0|62/66|b.40.4.5| RP:SCP:REP 63->283|1t9hA2|2e-12|38.7|212/212|c.37.1.8| HM:SCP:REP 1->62|1t9hA1|3.7e-18|41.9|62/0|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 63->283|1t9hA2|1.6e-55|38.9|221/0|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 838 OP:NHOMOORG 724 OP:PATTERN ----------------------------------------------11--111--------------- --1-111111111111112-11111111111111112222111122112111232111--22-12122231-------1121-2-1--11211111---11111111211--------------11112211122111111---1121111111111111111111212111111111111111-------111222222221222222112211222111222222222222111111111111111111111121111111122111111111-11111111111111111111111111111111112111111111111112111111111111121111113121111111222211211111111111-11--1-----------------1------------11-11----1-----1---11-----1---1--1----1---------------------------------------------------1111111111111111111111111111111111111111111111111111111121111111111111111111-11-1211--2-2211111111-11-------------------------1---111111111111111111211111122121--1-1-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----11111111311111111111111111111111111111111111111111111111111111222231111122222111111111111111121111222111111112-111111-11111111111111111111211111111-11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------1--1117111-111-2-22------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 96.6 SQ:SECSTR #EEEEEEEETTEEEEccccEEEEEEccccccccccccccTcEEEEEccTTccEEEEEccccTTHHHHHHHTTccEEEEEEETTcTHHHHHHHHHHHHHHHHHTcEEEEEEEEEcTTccEEEEEEEEEcTTHHHHHcHHHGGGccEEEEEEccccccccccEEEEEEEEEEGGEEEEEEccccccHHHHHcccEEEEEETTTTEEEEEcccccccccHHHHHHHHHHHGGEEETTcHHHHHTHHHHHHHHHHHHTTccEEEEcHHHHHHHHHHHHHHHTTcccc######### DISOP:02AL 276-293| PSIPRED ccEEEEEEEccEEEEEEccEEEEEEEcccccccccccEEccEEEEEEcccccEEEEEEEcccccEEccccccccEEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHcccEEEEcHHHHHHHccccEEEEEccccccHHHHHHHHcccccEEEEccccccccccccEEEEEEEEccccEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //