[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56092.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:254 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->111 3g0kA PDBj 3e-07 35.1 %
:RPS:PDB   3->112 1dmnA PDBj 2e-09 15.5 %
:RPS:PDB   133->237 2bngC PDBj 2e-08 18.4 %
:RPS:SCOP  1->112 1m98A2  d.17.4.6 * 5e-09 8.0 %
:RPS:SCOP  138->248 1sjwA  d.17.4.9 * 2e-13 24.5 %
:HMM:SCOP  1->114 1sjwA_ d.17.4.9 * 2.2e-15 31.8 %
:HMM:SCOP  138->248 1sjwA_ d.17.4.9 * 2.6e-13 31.8 %
:RPS:PFM   146->237 PF07366 * SnoaL 5e-05 36.8 %
:HMM:PFM   18->114 PF07366 * SnoaL 1.7e-10 25.3 95/126  
:HMM:PFM   143->241 PF07366 * SnoaL 8.8e-11 31.3 99/126  
:REPEAT 2|17->109|153->237
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56092.1 GT:GENE ACF56092.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1684667..1685431) GB:FROM 1684667 GB:TO 1685431 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF07366 GB:PROTEIN_ID ACF56092.1 GB:DB_XREF GI:194357644 LENGTH 254 SQ:AASEQ MSQQVKNAHNLYIHAIQDGRVAEAQAQSVGDTYIQHSTGVPDGKEGFAAFFADFFERHPERQIKIVRTIEDGNLVFVHVHQYLNGGEAQWVTTDTFRADENGCIVEHWDVIDYYRTPENDQLDQIFGDFEIKDLDKKAENKKLVRRFLTEIFQNGELEQWSDYVADDLIQHNHEIGQGSAAYKNYVAEYSVTFDFVFQLLGQGNYVVSYGQTQIDGVAYAQYDIFRLENGKIVEHWDNKEVMPKVEDLTNRGKF GT:EXON 1|1-254:0| NREPEAT 1 REPEAT 2|17->109|153->237| SEG 47->55|faaffadff| BL:PDB:NREP 1 BL:PDB:REP 33->111|3g0kA|3e-07|35.1|77/124| RP:PDB:NREP 2 RP:PDB:REP 3->112|1dmnA|2e-09|15.5|110/123| RP:PDB:REP 133->237|2bngC|2e-08|18.4|98/138| RP:PFM:NREP 1 RP:PFM:REP 146->237|PF07366|5e-05|36.8|87/126|SnoaL| HM:PFM:NREP 2 HM:PFM:REP 18->114|PF07366|1.7e-10|25.3|95/126|SnoaL| HM:PFM:REP 143->241|PF07366|8.8e-11|31.3|99/126|SnoaL| RP:SCP:NREP 2 RP:SCP:REP 1->112|1m98A2|5e-09|8.0|112/142|d.17.4.6| RP:SCP:REP 138->248|1sjwA|2e-13|24.5|110/142|d.17.4.9| HM:SCP:REP 1->114|1sjwA_|2.2e-15|31.8|107/0|d.17.4.9|1/2|NTF2-like| HM:SCP:REP 138->248|1sjwA_|2.6e-13|31.8|110/0|d.17.4.9|2/2|NTF2-like| OP:NHOMO 71 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- -----1-------------------------------1-------------------------------------------------------------------1-----------------------------------------------------------------------------1---------------------------------1-----------------------------------------------------------------------11111111111-------------111---111-------------------------------------------------1---------------------------------------1-----------11--1--------------------2----------------------------------------------------11--122222---------------2-------------1------1-------1-------------------------------1------------------------------------------------2-1----------------1--33-------------------------------------------------------11---------------------------------------------------------1111-------2---1111--------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 235 STR:RPRED 92.5 SQ:SECSTR ccHHHHHHHHHHHHHHHHTcHHHHHTTEEEEEEccTTcccEEHHHHHHHHHHHHcccEEEEccccEEccccEEEEEEEEEEEETTEEEEEEEEEEEEEcTTccEEEEEEEccccc################HcccHHHHHHHHHHHHHHHHHHHTcHHHHHHHEEEEEEEEETTTETTTcEEEEEEEEEEEETTEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEEETTEEEEEEEEEcHHHHHHHHHTc### DISOP:02AL 1-3,253-255| PSIPRED ccHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEEEEccEEEEEEccccccccccEEEEEEEEEEcccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHcccccccHHHHHHHHHHHccccccEEEEEEEEccEEEEEEEEEEccccEEEEEEEEEEccEEEEEEcccccccccccccccccc //