[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56093.1
DDBJ      :             sucrose-6-phosphate hydrolase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  263/915 : Eukaryota  70/199 : Viruses  0/175   --->[See Alignment]
b.29.1b.67.2
:439 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->421 1uypA PDBj 7e-54 35.4 %
:RPS:PDB   23->338 2ac1A PDBj 6e-77 32.2 %
:RPS:SCOP  26->336 1uypA2  b.67.2.3 * 5e-54 37.5 %
:RPS:SCOP  360->430 1y4wA1  b.29.1.19 * 6e-11 28.2 %
:HMM:SCOP  20->337 1y4wA2 b.67.2.3 * 5.6e-111 49.0 %
:HMM:SCOP  307->433 1y4wA1 b.29.1.19 * 1.8e-10 25.6 %
:RPS:PFM   31->334 PF00251 * Glyco_hydro_32N 2e-69 49.5 %
:HMM:PFM   31->336 PF00251 * Glyco_hydro_32N 1.4e-101 48.3 292/308  
:HMM:PFM   359->419 PF08244 * Glyco_hydro_32C 1.7e-09 23.0 61/86  
:BLT:SWISS 19->420 SCR_ZYMMO 2e-74 42.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56093.1 GT:GENE ACF56093.1 GT:PRODUCT sucrose-6-phosphate hydrolase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1620438..1621757) GB:FROM 1620438 GB:TO 1621757 GB:DIRECTION - GB:PRODUCT sucrose-6-phosphate hydrolase GB:NOTE identified by match to protein family HMM PF00251; match to protein family HMM TIGR01322 GB:PROTEIN_ID ACF56093.1 GB:DB_XREF GI:194357645 LENGTH 439 SQ:AASEQ MINKTFTVEKANRFIAENKHLVNTQYKPEEHFSAEIGWINDPNGFVYFRGEYHLFYQFYPYDSVWGPMHWGHAKSKDLVTWEHLPVALAPDQDYDRNGCFSGSAIVKDDRLWLMYTGHIEEETGVRQVQNMAFSDDGIHFEKISQNPVATGADLPDELIAADFRDPKLFEKDGRYYSVVATKHKDNVGCIVLLGSDNLVEWQFESIFLKGVEHQGFMWECPDYFELDGKDCLIMSPMRYQREGDSYHNINSSLLFTGKVEWGEKCFIPESVQEIDHGQDFYAPQTLLDDQNRRILIAWMQTWGRTLPTHDQEHKWACAMTLPRILRLEDGKLRQFPVKKGQYQIQIDKDCHYHLGNDIDYLEFGYDSNAQQVYIDRSHLIQKILGEEEQDTSRRYVDIEAKELEVVLDKNSIEIFVNQGEASLTATYYLTVPAELSRID GT:EXON 1|1-439:0| BL:SWS:NREP 1 BL:SWS:REP 19->420|SCR_ZYMMO|2e-74|42.7|393/512| BL:PDB:NREP 1 BL:PDB:REP 26->421|1uypA|7e-54|35.4|376/432| RP:PDB:NREP 1 RP:PDB:REP 23->338|2ac1A|6e-77|32.2|307/537| RP:PFM:NREP 1 RP:PFM:REP 31->334|PF00251|2e-69|49.5|293/301|Glyco_hydro_32N| HM:PFM:NREP 2 HM:PFM:REP 31->336|PF00251|1.4e-101|48.3|292/308|Glyco_hydro_32N| HM:PFM:REP 359->419|PF08244|1.7e-09|23.0|61/86|Glyco_hydro_32C| RP:SCP:NREP 2 RP:SCP:REP 26->336|1uypA2|5e-54|37.5|291/294|b.67.2.3| RP:SCP:REP 360->430|1y4wA1|6e-11|28.2|71/164|b.29.1.19| HM:SCP:REP 20->337|1y4wA2|5.6e-111|49.0|314/0|b.67.2.3|1/1|Arabinanase/levansucrase/invertase| HM:SCP:REP 307->433|1y4wA1|1.8e-10|25.6|125/0|b.29.1.19|1/1|Concanavalin A-like lectins/glucanases| OP:NHOMO 554 OP:NHOMOORG 336 OP:PATTERN ------------------------1--1--1------------------------------------- 111--1--111-2------------------------------1-11-----556-------1---1----21112111---------2231-1------2--111-1----------------------------111-------------------------------------------------11--23111111---11-1--41441311--1---12-------41111111111111111111122--21-12-111--1111111----11111113222222222222211111111111112221112223---34-------1-1-1---112---1---1--------1---11----3--1---------2--------------------------1----------11-211121--------------------------221-----------------------------------1--1-----111111-1111---11111-1-1---------11-------------------------------------------------------------------------------------------113-----1-1--------------------------------1111-13-11---2-2--1--122-1111-1------222111-1----------------2--11111--1-----------------------------111111-----1--1----------1------1--------1111111-1111-----11111----------------------1---------------------2-----------1-1-----------1-111--- ------1-A4-----433124411323-------------------21-1344A3332-1211-11113---1--111111-----11----3-1-121-1-2-1--3----------------------------------------------------------2---1-----44-----328A78284--4333- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 437 STR:RPRED 99.5 SQ:SECSTR #HHTTcGGGcGGccccccGGGcccTTccccccccccEEEEEEEEEEEETTEEEEEEEEcTTcccccccEEEEEEEccccccEEEEEEEccccGGGTTcEEEEEEEcTTccEEEEEEEEccccTTccEEEEEEEEcccccEEEcTTccccccccTTTcccTTcEEccccEcTTccEEEEEEEEEETTEEEEEEEEEccccccEEcccccEEEETccccEEEEEEEEEEccccccTTccccTTccEEETTTTEEEEEEEEEETTTTEEEEcTccccccccccEEEEEEEETTTEEEEEEEEcccccccHHHHHHHTEEcEEcccEEEEEccccEEEEEcGGGGTcccEEccccccccccccccccEEccccccccTTcEEEcccccTTTEEccccTTcccccEEEEEEEETTEEEEEETTTEEEEEEEccccTTccEEEE# DISOP:02AL 1-4,15-16,19-19,433-440| PSIPRED ccccHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccccEEEEEccEEEEEEEEcccccccccEEEEEEEEccccccEEcccEEccccccccccEEEEEEEEEccEEEEEEEcccccccccEEEEEEEEEccccEEEEcccccEEEccccccccccccccccEEEEEccEEEEEEEEEEcccEEEEEEEEcccccEEEEcccccccccccEEEEEEEEEEEEccEEEEEEEEEEEEccccccccccEEEEEEEEEEccccEEcccccEEEEEcccEEEEEEEEcccccEEEEEEccccccccccccHHHcccccEEEEEEEEEEccEEEEEEHHHHHHHccccccEEEEEEcccEEEEEEEEccccEEEEEEccccccccccccccEEEEEcccccEEEEEEEEccEEEEEEcccEEEEEEEEcccccHHccccc //