[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56102.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:43 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->42 PF12459 * DUF3687 4.5e-20 47.6 42/42  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56102.1 GT:GENE ACF56102.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2011349..2011480) GB:FROM 2011349 GB:TO 2011480 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56102.1 GB:DB_XREF GI:194357654 LENGTH 43 SQ:AASEQ MKQRKELYLFLGRTALYFLIFLGLLYFFSYLGQGQGSFIYNEF GT:EXON 1|1-43:0| TM:NTM 1 TM:REGION 12->34| SEG 16->34|lyfliflgllyffsylgqg| HM:PFM:NREP 1 HM:PFM:REP 1->42|PF12459|4.5e-20|47.6|42/42|DUF3687| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccEEccc //