[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56116.1
DDBJ      :             ABC transporter ATP-binding protein/ substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  241/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:276 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->265 2q2cA PDBj 4e-15 23.7 %
:RPS:PDB   40->267 2a5sA PDBj 5e-26 14.2 %
:RPS:SCOP  40->265 1ii5A  c.94.1.1 * 2e-26 18.8 %
:HMM:SCOP  35->271 1hslA_ c.94.1.1 * 6.2e-44 28.1 %
:RPS:PFM   41->264 PF00497 * SBP_bac_3 6e-10 24.5 %
:HMM:PFM   40->266 PF00497 * SBP_bac_3 1.1e-46 27.3 220/225  
:BLT:SWISS 40->266 TCYA_BACSU 5e-19 29.8 %
:PROS 142->157|PS00012|PHOSPHOPANTETHEINE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56116.1 GT:GENE ACF56116.1 GT:PRODUCT ABC transporter ATP-binding protein/ substrate-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 151534..152364 GB:FROM 151534 GB:TO 152364 GB:DIRECTION + GB:PRODUCT ABC transporter ATP-binding protein/ substrate-binding protein GB:NOTE identified by match to protein family HMM PF00497 GB:PROTEIN_ID ACF56116.1 GB:DB_XREF GI:194357668 LENGTH 276 SQ:AASEQ MKKIVKYSSLAALGLVAAGLLAACSGGAKKEGEAASKKEIIVATNGSPRPFIYEENGELTGYEIEVVRAIFKDSDKYDVXFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAYNAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPSDQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 40->266|TCYA_BACSU|5e-19|29.8|215/268| PROS 142->157|PS00012|PHOSPHOPANTETHEINE|PDOC00012| TM:NTM 1 TM:REGION 6->27| SEG 8->39|sslaalglvaagllaacsggakkegeaaskke| SEG 127->143|vlvvkkddssikslddi| BL:PDB:NREP 1 BL:PDB:REP 40->265|2q2cA|4e-15|23.7|219/231| RP:PDB:NREP 1 RP:PDB:REP 40->267|2a5sA|5e-26|14.2|226/278| RP:PFM:NREP 1 RP:PFM:REP 41->264|PF00497|6e-10|24.5|216/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 40->266|PF00497|1.1e-46|27.3|220/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 40->265|1ii5A|2e-26|18.8|213/222|c.94.1.1| HM:SCP:REP 35->271|1hslA_|6.2e-44|28.1|231/238|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 335 OP:NHOMOORG 242 OP:PATTERN -----------------------1-------------------------------------------- --------------1------1---1------1-----11----1----11-1111-1-----------------------1-----------------------------------------------------------111--------1--------------------------------1------24-1111121112111211--24112-11132111111-3111111111111111111111----1212---221111-1--3-22222242221332222222222222222222222221114331112-1-1-1212222-1--1---111-------------1------------2--------1--11----------------------2--------1-1--2--1--112-11-------------------------------------------------------------------2211-1122------1122------1-2-1--------------1----------1-1111111---------------------------------------211-----------------------1---1-----1-----------------------1----------111-1---------------------------------1122-1111111111111111--------------------------------------2-----1--1111------------11-------31-1----1111-----------11------11111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 85.9 SQ:SECSTR #######################################EEEEEEcccccccEEEEEEEEcHHHHHHHHHHHHcccccccEETTEEcHHHHHHHTTcccEEcccccccHHHHTTEEEcccEEETTcccccTTcHHHHcGGGccccccEEccTTcHHHHHHHTTcHHHHHHHGGGcccEccHHHHHHHHHTTcccEEEEEHHHHHHHHHTcTTccEEEEEcccGGGcEEEccEEETTcTTHHHHHHHHHHHHHHTHHHHHHHHHTccccccEccccc DISOP:02AL 1-4,271-277| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccEEEEEEccccccEEcccccEEEEHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHccccEEEccEEEEEEccccccccHHHHcccEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHcccccEEEEcHHHHHHHHHHcccccEEEEcccccccccEEEEEccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccc //