[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56119.1
DDBJ      :             CrcB protein
Swiss-Prot:CRCB1_STRPN  RecName: Full=Protein crcB homolog 1;

Homologs  Archaea  1/68 : Bacteria  174/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:RPS:PFM   3->107 PF02537 * CRCB 6e-06 41.0 %
:HMM:PFM   4->107 PF02537 * CRCB 2.8e-29 46.2 104/117  
:BLT:SWISS 1->109 CRCB1_STRPN 4e-59 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56119.1 GT:GENE ACF56119.1 GT:PRODUCT CrcB protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1161946..1162275) GB:FROM 1161946 GB:TO 1162275 GB:DIRECTION - GB:PRODUCT CrcB protein GB:NOTE identified by match to protein family HMM PF02537 GB:PROTEIN_ID ACF56119.1 GB:DB_XREF GI:194357671 LENGTH 109 SQ:AASEQ MVIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRLLSDKKVFYSYLTLTYIGGLVAIFLGILL GT:EXON 1|1-109:0| SW:ID CRCB1_STRPN SW:DE RecName: Full=Protein crcB homolog 1; SW:GN Name=crcB1; OrderedLocusNames=SP_1294; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->109|CRCB1_STRPN|4e-59|100.0|109/109| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 1->23| TM:REGION 28->50| TM:REGION 87->109| RP:PFM:NREP 1 RP:PFM:REP 3->107|PF02537|6e-06|41.0|105/115|CRCB| HM:PFM:NREP 1 HM:PFM:REP 4->107|PF02537|2.8e-29|46.2|104/117|CRCB| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02537|IPR003691| OP:NHOMO 177 OP:NHOMOORG 176 OP:PATTERN ---1---------------------------------------------------------------- --------------1----------------------1-1--------------------------------111-------------11-1-------11-1------------------------111111111----------------------------------------------------------111111111111111------1-1-11----111111---11111111-1111111112-1-1--1--11--1-------------------1--11111111111-------------1-------------1-------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1--------------------11----------------------------------------1-111111---------------------------111-----------------------11-1--111-11111-11-111111111111-111--1-----1111111111111111-1111111--111111111111---------------1-----1-----------11-1111---1------1-----------------------------------------------------------------------------------------------------------1 --------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHc //