[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56128.1
DDBJ      :             addiction module antitoxin, RelB/DinJ family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->69 PF04221 * RelB 6e-08 38.5 %
:HMM:PFM   5->76 PF04221 * RelB 2.2e-17 33.3 72/83  
:BLT:SWISS 1->77 Y710_HAEIN 2e-05 29.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56128.1 GT:GENE ACF56128.1 GT:PRODUCT addiction module antitoxin, RelB/DinJ family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 252704..252967 GB:FROM 252704 GB:TO 252967 GB:DIRECTION + GB:PRODUCT addiction module antitoxin, RelB/DinJ family GB:NOTE identified by match to protein family HMM PF04221; match to protein family HMM TIGR02384 GB:PROTEIN_ID ACF56128.1 GB:DB_XREF GI:194357680 LENGTH 87 SQ:AASEQ MSKMSISIRLDSEVKEQAQQVFSNLGMDMTTAINIFLRQAIQYQGLPFDVRLDENRKLLQALTDLDQNRNMSQSFESVSDLMEDLRA GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 1->77|Y710_HAEIN|2e-05|29.9|77/98| RP:PFM:NREP 1 RP:PFM:REP 5->69|PF04221|6e-08|38.5|65/81|RelB| HM:PFM:NREP 1 HM:PFM:REP 5->76|PF04221|2.2e-17|33.3|72/83|RelB| OP:NHOMO 32 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------1111--1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------11111111111-------------------------------------------------1------122--3----------3---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHcc //