[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56137.1
DDBJ      :             magnesium transporter, CorA family protein, putative
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  144/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.328.1f.17.3
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->123 1dljA PDBj 2e-04 24.8 %
:RPS:PDB   1->230 3ck6C PDBj 5e-19 8.3 %
:RPS:SCOP  10->147 2bbhA1  d.328.1.1 * 9e-10 14.2 %
:HMM:SCOP  8->236 2iubA1 d.328.1.1 * 2.3e-35 24.3 %
:HMM:SCOP  237->299 2iubA2 f.17.3.1 * 4.2e-12 30.2 %
:RPS:PFM   13->301 PF01544 * CorA 1e-13 25.4 %
:HMM:PFM   10->297 PF01544 * CorA 1.4e-58 23.4 286/292  
:BLT:SWISS 10->149 YF2E_SCHPO 3e-05 20.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56137.1 GT:GENE ACF56137.1 GT:PRODUCT magnesium transporter, CorA family protein, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1602978..1603886) GB:FROM 1602978 GB:TO 1603886 GB:DIRECTION - GB:PRODUCT magnesium transporter, CorA family protein, putative GB:NOTE identified by match to protein family HMM PF01544 GB:PROTEIN_ID ACF56137.1 GB:DB_XREF GI:194357689 LENGTH 302 SQ:AASEQ MVLEKQLGNGCTWIDLDLGKLNKLEDLSEIYGLDKETIEYALDRNERAHMDYHRESGTVTFXYNVLDVKKDKAYYETFPMTFIVEHRRLITISNTKNAYVIEQMTRYLESHDTLSIYKFLFASLEIISNAYYPVIEQMDKSRDEVNDLLRQRTTKKNLFALSDLETGMVYLTAAAKQNRILLEHIQGHALYRSFDEIEREQFDDAMIEAHQLVSMTDLISQILQQLSASYNNILNNNLNDNLTTLTIISVLLAVLAVVTGFFGMNVPLPLTDEPHAWLYISLASAGLWIVLSLLLRKIAKKS GT:EXON 1|1-302:0| BL:SWS:NREP 1 BL:SWS:REP 10->149|YF2E_SCHPO|3e-05|20.9|139/617| TM:NTM 2 TM:REGION 245->267| TM:REGION 277->295| SEG 231->259|nnilnnnlndnlttltiisvllavlavvt| BL:PDB:NREP 1 BL:PDB:REP 12->123|1dljA|2e-04|24.8|105/402| RP:PDB:NREP 1 RP:PDB:REP 1->230|3ck6C|5e-19|8.3|216/236| RP:PFM:NREP 1 RP:PFM:REP 13->301|PF01544|1e-13|25.4|283/291|CorA| HM:PFM:NREP 1 HM:PFM:REP 10->297|PF01544|1.4e-58|23.4|286/292|CorA| GO:PFM:NREP 4 GO:PFM GO:0016020|"GO:membrane"|PF01544|IPR002523| GO:PFM GO:0030001|"GO:metal ion transport"|PF01544|IPR002523| GO:PFM GO:0046873|"GO:metal ion transmembrane transporter activity"|PF01544|IPR002523| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01544|IPR002523| RP:SCP:NREP 1 RP:SCP:REP 10->147|2bbhA1|9e-10|14.2|134/223|d.328.1.1| HM:SCP:REP 8->236|2iubA1|2.3e-35|24.3|226/0|d.328.1.1|1/1|CorA soluble domain-like| HM:SCP:REP 237->299|2iubA2|4.2e-12|30.2|63/0|f.17.3.1|1/1|Magnesium transport protein CorA, transmembrane region| OP:NHOMO 191 OP:NHOMOORG 149 OP:PATTERN --------------------------------------------11-1---1---------------- -----------------------------------------------------------------------1---111---------------1------------------------------------------------------------------------------------------11----1-1-111111111111111------111111----3333331-111111111111111111111111231111122111-11-1112223331---2--22222222222-1111------1-2-12221111---11111111111111111111------11--1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 230 STR:RPRED 76.2 SQ:SECSTR ccTTcccccTTEEEEEETTcTTHHHHHHHHTTccHHHHHHHHccccccEEEEccTTcEEEcEEEEEEcccTTccTTcEEEEEEEETTEEEEEEccccHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTcGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcTcHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH######################################################################## DISOP:02AL 150-158,302-303| PSIPRED cccEEEccccEEEEEcccccHHHHHHHHHHHcccHHHHHHHHcccccccEEEEcccEEEEEEEEEEEccccccEEEEEEEEEEEEccEEEEEEccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //