[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56138.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  142/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.98.2d.37.1d.38.1
:425 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   70->183 2iojA PDBj 2e-09 34.2 %
:BLT:PDB   198->302 2yvyA PDBj 4e-06 27.6 %
:RPS:PDB   5->59 1bibA PDBj 2e-09 15.4 %
:RPS:PDB   164->306 1e6vC PDBj 1e-09 9.2 %
:RPS:PDB   297->422 3e1eB PDBj 2e-09 13.0 %
:RPS:SCOP  5->57 1qbjA  a.4.5.19 * 1e-08 26.4 %
:RPS:SCOP  70->183 2iojA1  c.98.2.2 * 2e-19 32.7 %
:RPS:SCOP  201->306 2v8qE1  d.37.1.1 * 5e-12 15.1 %
:RPS:SCOP  296->424 1q4sA  d.38.1.5 * 4e-10 12.5 %
:HMM:SCOP  2->54 1qgpA_ a.4.5.19 * 6.3e-06 32.1 %
:HMM:SCOP  67->181 1knxA1 c.98.2.1 * 1.4e-22 33.3 %
:HMM:SCOP  183->241 1pvmA2 d.37.1.1 * 4e-06 31.6 %
:HMM:SCOP  240->307 2nycA1 d.37.1.1 * 2.7e-10 20.6 %
:HMM:SCOP  305->424 1zkiA1 d.38.1.5 * 1.5e-11 22.7 %
:RPS:PFM   13->57 PF00392 * GntR 2e-04 46.7 %
:RPS:PFM   74->175 PF07085 * DRTGG 7e-23 49.0 %
:RPS:PFM   157->300 PF00478 * IMPDH 1e-04 25.9 %
:RPS:PFM   365->408 PF03061 * 4HBT 1e-04 31.8 %
:HMM:PFM   74->176 PF07085 * DRTGG 6.4e-34 50.5 103/105  
:HMM:PFM   199->240 PF00571 * CBS 1.3e-08 31.0 42/57  
:HMM:PFM   251->304 PF00571 * CBS 1.5e-09 18.5 54/57  
:HMM:PFM   13->57 PF00392 * GntR 8.7e-08 37.8 45/64  
:HMM:PFM   342->412 PF03061 * 4HBT 3.8e-07 22.5 71/79  
:BLT:SWISS 67->186 Y039_SYNY3 2e-10 29.2 %
:BLT:SWISS 206->330 Y188_METJA 2e-06 25.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56138.1 GT:GENE ACF56138.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 965634..966911 GB:FROM 965634 GB:TO 966911 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF00571; match to protein family HMM PF03061; match to protein family HMM PF07085; match to protein family HMM PF08279 GB:PROTEIN_ID ACF56138.1 GB:DB_XREF GI:194357690 LENGTH 425 SQ:AASEQ MSKHQEILSYLEELPVGKRVSVRSISNHLGVSDGTAYRAIKEAENRGIVETRPRSGTIRVKSQKVAIERLTFAEIAEVTSSEVLAGQEGLEREFSKFSIGAMTEQNILSYLHDGGLLIVGDRTRIQLLALENENAVLVTGGFQVHDDVLKLANQKGIPVLRSKHDTFTVATMINKALSNVQIKTDILTVEKLYRPSHEYGFLRETDTVKDYLDLVRKNRSSRFPVINQHQVVVGVVTMRDAGDKSPSTTIDKVMSRSLFLVGLSTNIANVSQRMIAEDFEMVPVVRSNQTLLGVVTRRDVMEKMSRSQVSALPTFSEQIGQKLSYHHDEVVITVEPFMLEKNGVLANGVLAEILTHMTQDLVVNSGRNLIIEQMLIYFLQAVQIDDILRIQARIIHHTRRSAIIDYDIYHGHQIVSKANVTVKIN GT:EXON 1|1-425:0| BL:SWS:NREP 2 BL:SWS:REP 67->186|Y039_SYNY3|2e-10|29.2|120/357| BL:SWS:REP 206->330|Y188_METJA|2e-06|25.0|124/265| SEG 231->236|vvvgvv| BL:PDB:NREP 2 BL:PDB:REP 70->183|2iojA|2e-09|34.2|111/117| BL:PDB:REP 198->302|2yvyA|4e-06|27.6|105/248| RP:PDB:NREP 3 RP:PDB:REP 5->59|1bibA|2e-09|15.4|52/294| RP:PDB:REP 164->306|1e6vC|1e-09|9.2|142/248| RP:PDB:REP 297->422|3e1eB|2e-09|13.0|123/140| RP:PFM:NREP 4 RP:PFM:REP 13->57|PF00392|2e-04|46.7|45/64|GntR| RP:PFM:REP 74->175|PF07085|7e-23|49.0|102/105|DRTGG| RP:PFM:REP 157->300|PF00478|1e-04|25.9|139/459|IMPDH| RP:PFM:REP 365->408|PF03061|1e-04|31.8|44/79|4HBT| HM:PFM:NREP 5 HM:PFM:REP 74->176|PF07085|6.4e-34|50.5|103/105|DRTGG| HM:PFM:REP 199->240|PF00571|1.3e-08|31.0|42/57|CBS| HM:PFM:REP 251->304|PF00571|1.5e-09|18.5|54/57|CBS| HM:PFM:REP 13->57|PF00392|8.7e-08|37.8|45/64|GntR| HM:PFM:REP 342->412|PF03061|3.8e-07|22.5|71/79|4HBT| GO:PFM:NREP 5 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 4 RP:SCP:REP 5->57|1qbjA|1e-08|26.4|53/65|a.4.5.19| RP:SCP:REP 70->183|2iojA1|2e-19|32.7|113/120|c.98.2.2| RP:SCP:REP 201->306|2v8qE1|5e-12|15.1|106/145|d.37.1.1| RP:SCP:REP 296->424|1q4sA|4e-10|12.5|128/142|d.38.1.5| HM:SCP:REP 2->54|1qgpA_|6.3e-06|32.1|53/76|a.4.5.19|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 67->181|1knxA1|1.4e-22|33.3|114/132|c.98.2.1|1/1|HPr kinase/phoshatase HprK N-terminal domain| HM:SCP:REP 183->241|1pvmA2|4e-06|31.6|57/78|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 240->307|2nycA1|2.7e-10|20.6|68/0|d.37.1.1|2/2|CBS-domain| HM:SCP:REP 305->424|1zkiA1|1.5e-11|22.7|119/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 147 OP:NHOMOORG 145 OP:PATTERN -----------------------11--1---------------------------------------- ------------------------------------------------------1----------------------------------------------1--------------------------------------------1-----------------------1--------------------111111121111111111111111111111111111111111111111111111111111111---11---------111-----11111111111111111111111111111111111111--111---1---1-1111111-1-1-111--111----111-11-----11-112----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 424 STR:RPRED 99.8 SQ:SECSTR HcHHHHHHHHHTTTcTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEccHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcccccTTcccccccTTccccccccccccTTGGGccccHHHHHHTccEEEccHHHHHHHHHccccEEEEccccEEEEEEHHHHHHHHHHHHHcTTccTTTEEEcccccccTTccccTTcccccTTEETTTTEEEEEEcTTccEEEEEEEccccccHHHHHTTcccccTTcccGGGcHHcHHHHHHHHHHHHHHHHHHccHTcHHHHHHTcEEEEccTEEEEEccGGGccTTccccHHHHHHHHHHHHHHTTcccccEEEEEEEEEEEcccccTccEEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEE# DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHccccccEEEEEHHccccccccccEEHHHHHHccccEEEcccccccEEEEEcccccccccHHHHHHHHccEEEEccccHHEEEEEEEEEEEcHHHHHHHcccccEEEEccHHHHHHHHHccccEEEEccccccHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEHHHHHcccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHcccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEEccEEEEEEEEEEEEccEEEEEEEEccccEEEEEEEEEEEEc //