[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56142.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.287.1
:103 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  5->88 2h5nA1  a.287.1.2 * 5e-04 11.4 %
:HMM:PFM   38->56 PF08369 * PCP_red 0.00012 42.1 19/45  
:HMM:PFM   49->100 PF11769 * DUF3313 0.00076 15.4 52/201  
:BLT:SWISS 3->46 CTU2_VANPO 7e-04 40.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56142.1 GT:GENE ACF56142.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 806353..806664 GB:FROM 806353 GB:TO 806664 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56142.1 GB:DB_XREF GI:194357694 LENGTH 103 SQ:AASEQ MELKDFTEKEQEMIKKRLTMSNISDKETTEKILALVPQDLIKRIPFFVRKHATTRTIKRISIEHPELYAVAQTSGEIPEKECEELRQIITTIFEQKMNKHSIK GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 3->46|CTU2_VANPO|7e-04|40.9|44/100| HM:PFM:NREP 2 HM:PFM:REP 38->56|PF08369|0.00012|42.1|19/45|PCP_red| HM:PFM:REP 49->100|PF11769|0.00076|15.4|52/201|DUF3313| RP:SCP:NREP 1 RP:SCP:REP 5->88|2h5nA1|5e-04|11.4|79/132|a.287.1.2| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1--11111211111-------------1------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-6,74-82,99-104| PSIPRED ccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccc //