[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56146.1
DDBJ      :             Tn5253 conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   69->105 PF01320 * Colicin_Pyocin 0.00019 31.4 35/85  
:BLT:SWISS 47->116 LON_HELPY 9e-04 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56146.1 GT:GENE ACF56146.1 GT:PRODUCT Tn5253 conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1238348..1238758) GB:FROM 1238348 GB:TO 1238758 GB:DIRECTION - GB:PRODUCT Tn5253 conserved hypothetical protein GB:PROTEIN_ID ACF56146.1 GB:DB_XREF GI:194357698 LENGTH 136 SQ:AASEQ MEAIYQRDSDQDGLTDAQELALGTNPLSSDSDGDGRSDLVEIEEGTNPLEKDLQDIDQTSITESSSVFMEMKQKISDMMESHYKEFILALISIETGIENQQDLEDLYTYYMRMDAVSLLSSDLETSPQEVEMEIEL GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 47->116|LON_HELPY|9e-04|34.8|69/835| SEG 28->38|ssdsdgdgrsd| HM:PFM:NREP 1 HM:PFM:REP 69->105|PF01320|0.00019|31.4|35/85|Colicin_Pyocin| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,58-58| PSIPRED ccccccccccccccccHHHHHHccccccccccccccccHHHHHccccccccccccccccccccHHHHHHcccccHHHHHcHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHcccHHHHEEEccc //