[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56147.1
DDBJ      :             tyrosine recombinase XerC
Swiss-Prot:XERS_STRZT   RecName: Full=Tyrosine recombinase xerS;

Homologs  Archaea  25/68 : Bacteria  718/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.60.9d.163.1
:356 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   201->356 2a3vB PDBj 1e-10 30.8 %
:RPS:PDB   97->353 1a0pA PDBj 7e-24 24.1 %
:RPS:SCOP  21->123 1crxA1  a.60.9.1 * 1e-04 18.5 %
:RPS:SCOP  185->353 1a0pA2  d.163.1.1 * 1e-21 26.9 %
:HMM:SCOP  172->354 1a0pA2 d.163.1.1 * 9.8e-34 28.5 %
:RPS:PFM   22->120 PF02899 * Phage_integr_N 9e-06 40.8 %
:RPS:PFM   196->348 PF00589 * Phage_integrase 6e-15 32.9 %
:HMM:PFM   179->345 PF00589 * Phage_integrase 1.6e-27 28.5 158/173  
:HMM:PFM   34->123 PF02899 * Phage_integr_N 1.8e-07 26.1 69/84  
:HMM:PFM   122->169 PF10661 * EssA 0.00051 32.6 46/166  
:BLT:SWISS 1->356 XERS_STRZT 0.0 99.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56147.1 GT:GENE ACF56147.1 GT:PRODUCT tyrosine recombinase XerC GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1035466..1036536 GB:FROM 1035466 GB:TO 1036536 GB:DIRECTION + GB:PRODUCT tyrosine recombinase XerC GB:NOTE identified by match to protein family HMM PF00589 GB:PROTEIN_ID ACF56147.1 GB:DB_XREF GI:194357699 LENGTH 356 SQ:AASEQ MKREILLERIDKLKQLMPWYVLEYYQSKLAVPYSFTTLYEYLKEYDRFFSWVLESGISNADKISDIPLSVLENMSKKDMESFILYXRERPLLNANTTKQGVSQTTINRTLSALSSLYKYLTEEVENDQGEPYFYRNVMKKVSTKKKKETLAARAENIKQKLFLGDETEGFLTYIDQEHPQQLSNRALSSFNKNKERDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSVNVAAFAKPYLENYLAIRNQRYKTEKTDTALFLTLYRGVPNRIDASSVEKMVAKYSEDFKVRVTPHKLRHTLATRLYDATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDSL GT:EXON 1|1-356:0| SW:ID XERS_STRZT SW:DE RecName: Full=Tyrosine recombinase xerS; SW:GN Name=xerS; OrderedLocusNames=SPT_1185; SW:KW Cell cycle; Cell division; Chromosome partition; Complete proteome;Cytoplasm; DNA integration; DNA recombination; DNA-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->356|XERS_STRZT|0.0|99.7|356/356| GO:SWS:NREP 7 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0007059|"GO:chromosome segregation"|Chromosome partition| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0015074|"GO:DNA integration"|DNA integration| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| SEG 139->147|kkvstkkkk| BL:PDB:NREP 1 BL:PDB:REP 201->356|2a3vB|1e-10|30.8|156/320| RP:PDB:NREP 1 RP:PDB:REP 97->353|1a0pA|7e-24|24.1|249/271| RP:PFM:NREP 2 RP:PFM:REP 22->120|PF02899|9e-06|40.8|76/84|Phage_integr_N| RP:PFM:REP 196->348|PF00589|6e-15|32.9|149/168|Phage_integrase| HM:PFM:NREP 3 HM:PFM:REP 179->345|PF00589|1.6e-27|28.5|158/173|Phage_integrase| HM:PFM:REP 34->123|PF02899|1.8e-07|26.1|69/84|Phage_integr_N| HM:PFM:REP 122->169|PF10661|0.00051|32.6|46/166|EssA| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF02899|IPR004107| GO:PFM GO:0015074|"GO:DNA integration"|PF02899|IPR004107| GO:PFM GO:0003677|"GO:DNA binding"|PF00589|IPR002104| GO:PFM GO:0006310|"GO:DNA recombination"|PF00589|IPR002104| GO:PFM GO:0015074|"GO:DNA integration"|PF00589|IPR002104| RP:SCP:NREP 2 RP:SCP:REP 21->123|1crxA1|1e-04|18.5|81/110|a.60.9.1| RP:SCP:REP 185->353|1a0pA2|1e-21|26.9|167/180|d.163.1.1| HM:SCP:REP 172->354|1a0pA2|9.8e-34|28.5|179/182|d.163.1.1|1/1|DNA breaking-rejoining enzymes| OP:NHOMO 1320 OP:NHOMOORG 744 OP:PATTERN -----1--111111--1---------------1-1--1-11---1-11-------111111111---- 2121112222212211111-1222211111111111111-11211211211122221211--21123----22222223222------233121111--11123222211222222222222222222222222321111122212-111-----------------1-----------------1--222332232332332333334222222224535822322222243222222222222222222223333333133222333332222211311111111112112322222211111111111111112121111353213211212321213311111221311354434523132211142--2251--11--1-------------1----------------------1-----11-111-1-11-111--1--211111111111--1-2--22-2-222-1--1-111111111112211-1----11114222222122222212222222221222211-121121111121111112221-2222222222-21-232-224213112222222222211212223121111111111-1111111112111122222--21222222222222222222221--22112------22222222223222222-2222322232222222222222222122222232212222223222222221-222222222222---2---------2121-1111222111-1222222322121222222223231333312232222222222222222222222321112122111-111--21222222--------222---------1---------------11----1---122 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 333 STR:RPRED 93.5 SQ:SECSTR ############HHHHHHHHHHHHHTGGHHTGccHHHHHHHHHHHHHHHHHHHHTTccG###########TTTTcHHHHHHHHHHHHHHTcccHHHHTTcccHHHHHHHHHHHHHHHHHHHHTcccTcHHHHHTTccHHHHHHHHHccccHHHHHHHHHHHHHHHHHTTcccccTTcccccccHHcccTTcHHHHHHHHHHHHHHHHcccHHHHTTccGGGEETTTTEEEEEcccccEEEEEccHHHHHHHHHHHHHTHHHHHTTcccccccccTTcccccHHHHHHHHHHHHHHTTccGGGccHHHHHHHHHHHHHHHccccGGGccccccccHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHcHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHcccHHHEEccccEEEEEcccccEEEEEccHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccHHHHHHHHHHHHHHccccccHHccHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHccHHHHHHHHHcc //