[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56160.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->38 PF01653 * DNA_ligase_aden 0.00047 33.3 24/315  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56160.1 GT:GENE ACF56160.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 125742..125870 GB:FROM 125742 GB:TO 125870 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56160.1 GB:DB_XREF GI:194357712 LENGTH 42 SQ:AASEQ MLTISFKKQFLSSSLSSPTKRVIMNTAQATFNREAHTTFNRE GT:EXON 1|1-42:0| SEG 5->17|sfkkqflssslss| HM:PFM:NREP 1 HM:PFM:REP 15->38|PF01653|0.00047|33.3|24/315|DNA_ligase_aden| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,36-43| PSIPRED cEEEHHHHHHHHHHHccHHHHHHHHHHHHHcccHHccccccc //