[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56164.1
DDBJ      :             acylphosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.10
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->77 2fhmA PDBj 5e-11 44.6 %
:RPS:PDB   1->90 3br8A PDBj 3e-20 41.4 %
:RPS:SCOP  3->90 1ulrA  d.58.10.1 * 1e-19 30.6 %
:HMM:SCOP  1->92 2acyA_ d.58.10.1 * 6e-20 37.8 %
:RPS:PFM   1->90 PF00708 * Acylphosphatase 8e-17 50.6 %
:HMM:PFM   1->90 PF00708 * Acylphosphatase 1.4e-24 42.5 87/91  
:BLT:SWISS 1->90 ACYP_LACLA 5e-19 55.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56164.1 GT:GENE ACF56164.1 GT:PRODUCT acylphosphatase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1789974..1790252 GB:FROM 1789974 GB:TO 1790252 GB:DIRECTION + GB:PRODUCT acylphosphatase GB:NOTE identified by match to protein family HMM PF00708 GB:PROTEIN_ID ACF56164.1 GB:DB_XREF GI:194357716 LENGTH 92 SQ:AASEQ MQKVRMIAQGRVQGVGFRWGVYSLALEIGGITGRVWNNDDGTVEILAQADSSAIMAKFIQEIRKGPTPFSKVSYLDVKLSNFPPYSDFKIAN GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 1->90|ACYP_LACLA|5e-19|55.1|89/97| BL:PDB:NREP 1 BL:PDB:REP 1->77|2fhmA|5e-11|44.6|74/91| RP:PDB:NREP 1 RP:PDB:REP 1->90|3br8A|3e-20|41.4|87/90| RP:PFM:NREP 1 RP:PFM:REP 1->90|PF00708|8e-17|50.6|87/90|Acylphosphatase| HM:PFM:NREP 1 HM:PFM:REP 1->90|PF00708|1.4e-24|42.5|87/91|Acylphosphatase| RP:SCP:NREP 1 RP:SCP:REP 3->90|1ulrA|1e-19|30.6|85/87|d.58.10.1| HM:SCP:REP 1->92|2acyA_|6e-20|37.8|90/0|d.58.10.1|1/1|Acylphosphatase/BLUF domain-like| OP:NHOMO 63 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------11-----111--------------------------------1------11-111-----11---11111111111111111111111111111111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 97.8 SQ:SECSTR cEEEEEEEEEEcccccHHHHHHHHHHHTTTcEEEEEEcTTccEEEEEEEcHHHHHHHHHHHHHHcccTTcEEEEEEEEEccccccccEEE## DISOP:02AL 1-1,92-93| PSIPRED cEEEEEEEEEEEEEEcHHHHHHHHHHHHHccEEEEEEccccEEEEEEEEcHHHHHHHHHHHHHHcccccEEEEEEEEEEEccccccccEEcc //