[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56168.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->70 2dsyA PDBj 1e-11 14.9 %
:HMM:PFM   4->55 PF03681 * UPF0150 2.9e-21 45.8 48/48  
:HMM:PFM   79->133 PF01707 * Peptidase_C9 0.00082 21.8 55/202  
:BLT:SWISS 21->121 YO14_BPHP1 4e-05 28.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56168.1 GT:GENE ACF56168.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1616962..1617414) GB:FROM 1616962 GB:TO 1617414 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF03681 GB:PROTEIN_ID ACF56168.1 GB:DB_XREF GI:194357720 LENGTH 150 SQ:AASEQ MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPFKDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 21->121|YO14_BPHP1|4e-05|28.2|85/133| RP:PDB:NREP 1 RP:PDB:REP 1->70|2dsyA|1e-11|14.9|67/78| HM:PFM:NREP 2 HM:PFM:REP 4->55|PF03681|2.9e-21|45.8|48/48|UPF0150| HM:PFM:REP 79->133|PF01707|0.00082|21.8|55/202|Peptidase_C9| OP:NHOMO 32 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1--1111111111111-1----111-11----------11-----------1-----------1--2--1--1------------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 45.3 SQ:SECSTR HHHHHTcEEEEcccccc###EEEEcTTcTTcEEEEccHHHHHHHHHHHHHHHHHHHHHTTccccccTTccc############################################################################### DISOP:02AL 1-1,150-151| PSIPRED cccEEEEEEEEccccccccEEEEEEccccHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccEEccHHHcccEEEEEEccccHHHcccccEEEEEcHHHHHHHHHHHHcccHHHHHHHHHHHHHHcc //