[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56171.1
DDBJ      :             primase homolog
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  174/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.136.1e.10.1
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->158 1cy0A PDBj 6e-11 14.0 %
:RPS:SCOP  7->158 1cy0A  e.10.1.1 * 2e-11 14.0 %
:HMM:SCOP  2->125 2fcjA1 c.136.1.1 * 2.1e-34 47.3 %
:HMM:PFM   7->75 PF01751 * Toprim 7.1e-10 23.2 69/96  
:BLT:SWISS 4->182 YABF_BACSU 3e-41 47.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56171.1 GT:GENE ACF56171.1 GT:PRODUCT primase homolog GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1804664..1805224) GB:FROM 1804664 GB:TO 1805224 GB:DIRECTION - GB:PRODUCT primase homolog GB:NOTE identified by match to protein family HMM PF01751; match to protein family HMM TIGR00334 GB:PROTEIN_ID ACF56171.1 GB:DB_XREF GI:194357723 LENGTH 186 SQ:AASEQ MKEKISQVIVVEGRDDTVNLKRYFDVETYETRGSAINDQDIERIQRLHQRHGVIVFTDPDFNGERIRRMIMTVIPTVQHAFLKRDEAVPKSKTKGRSLGIEHASYEDLKTALAQVTEQFEHESQFDISRSDLIRLGFLVGADSRKRREYLGETLRIGYSNGKQLLKRLELFGVTLAEVEEAMKSYE GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 4->182|YABF_BACSU|3e-41|47.4|175/186| RP:PDB:NREP 1 RP:PDB:REP 7->158|1cy0A|6e-11|14.0|136/534| HM:PFM:NREP 1 HM:PFM:REP 7->75|PF01751|7.1e-10|23.2|69/96|Toprim| RP:SCP:NREP 1 RP:SCP:REP 7->158|1cy0A|2e-11|14.0|136/534|e.10.1.1| HM:SCP:REP 2->125|2fcjA1|2.1e-34|47.3|112/0|c.136.1.1|1/1|Toprim domain| OP:NHOMO 175 OP:NHOMOORG 174 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111-11111111111111-1111111-1-11---1-11-------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-----1----1---1--1-----111--111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 94.6 SQ:SECSTR ######EEEEEccHHHHHHHGGGcEcccHHHHHTEETTTTHHHHHHHHTTccEEEcccccHHHHHHHHHHHHHHGGGHHTTcEEEHHHcccGGGEEEcccccccHHHHHHHHHccccccHHHHHHHHHHHHHHGcHHHHHHHHHHHHHHTcTTccccTHHHHHHHHHHHHHcccHHHHTTcc#### DISOP:02AL 1-3,186-187| PSIPRED ccccccEEEEEEcccHHHHHHHHHcEEEEEEccccccHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHccccEEEEEcHHHccccccccccccEEEEccHHHHHHHHHHcHHHcccccHHcccHHHHHHccccccccHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccc //