[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56173.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.48
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->90 2iboA PDBj 2e-40 98.9 %
:RPS:PDB   1->93 2ekyG PDBj 4e-09 24.7 %
:RPS:SCOP  2->90 2iboA1  d.58.48.1 * 7e-33 96.6 %
:HMM:SCOP  1->93 1s7hA_ d.58.48.2 * 2.8e-24 38.5 %
:HMM:PFM   6->91 PF01910 * DUF77 5.3e-17 26.7 86/92  
:BLT:SWISS 4->91 Y1503_CLOPE 5e-11 36.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56173.1 GT:GENE ACF56173.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2038989..2039279) GB:FROM 2038989 GB:TO 2039279 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56173.1 GB:DB_XREF GI:194357725 LENGTH 96 SQ:AASEQ MKASIALQVLPLAQGIDRIAVIDQVIAYLQTQEVTMVVTPFETVLEGEFDELMRILKEALEVAGQEADNVFANVKINVGEILSIDEKLEKYTETTH GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 4->91|Y1503_CLOPE|5e-11|36.4|88/95| BL:PDB:NREP 1 BL:PDB:REP 2->90|2iboA|2e-40|98.9|87/87| RP:PDB:NREP 1 RP:PDB:REP 1->93|2ekyG|4e-09|24.7|93/96| HM:PFM:NREP 1 HM:PFM:REP 6->91|PF01910|5.3e-17|26.7|86/92|DUF77| RP:SCP:NREP 1 RP:SCP:REP 2->90|2iboA1|7e-33|96.6|89/90|d.58.48.1| HM:SCP:REP 1->93|1s7hA_|2.8e-24|38.5|91/186|d.58.48.2|1/1|MTH1187/YkoF-like| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1-----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------11-------------1111----------1--11111111111-------------------------------------------11-1---------11--------11----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 96.9 SQ:SECSTR cEEEEEEEEEEEccccccHHHHHHHHHHHTTcccEEEEccccEEEEEEHHHHHHHHHHHHHHHHTTccEEEEEEEEEccccccHHHHHHHTTc### DISOP:02AL 1-2,90-97| PSIPRED ccEEEEEEEEEEccccEEEHHHHHHHHHHHHccccEEEcccccEEcccHHHHHHHHHHHHHHHHccccEEEEEEEEEccccccHHHHHHHHccccc //