[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56176.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->57 PF09874 * DUF2101 2.6e-05 23.5 51/206  
:HMM:PFM   39->98 PF07738 * Sad1_UNC 0.00096 18.9 53/135  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56176.1 GT:GENE ACF56176.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1754714..1755265) GB:FROM 1754714 GB:TO 1755265 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56176.1 GB:DB_XREF GI:194357728 LENGTH 183 SQ:AASEQ MPANTKVIFQEMFADFQNYYVLIGGTATSIVLDSQGFKSRTTKDYDMVIIDEVKNKEFYTTLNHFLELGEYQGSQKDEKAQLFQFTTTNPEFPSMIELFSILPEYPLKKDGREIPLYFDQDASLSALLLDEDYYNILVHVKETIQGYSVLSNCGLYSSKISSNHVSFHLQPQNSVLSSLQLAS GT:EXON 1|1-183:0| SEG 121->130|daslsallld| HM:PFM:NREP 2 HM:PFM:REP 7->57|PF09874|2.6e-05|23.5|51/206|DUF2101| HM:PFM:REP 39->98|PF07738|0.00096|18.9|53/135|Sad1_UNC| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------1---2------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------1-----------------------11111111111-----------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,183-184| PSIPRED ccccHHEEHHHHHccccEEEEEEcccEEEEEEEcccccccccccccEEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEEEEEcccHHHHHHHHHHHHcccccccccccEEEEEEcccccEEEEEEccHHHHHHHHHHHHHccEEEEEccccccccccccEEEEEEcccHHHHHHccccc //