[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56194.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:546 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   122->193 1vm6D PDBj 9e-04 33.8 %
:RPS:PDB   60->388 1cgwA PDBj 7e-05 11.0 %
:HMM:PFM   501->524 PF09303 * KcnmB2_inactiv 0.00013 41.7 24/32  
:HMM:PFM   32->48 PF09145 * Ubiq-assoc 0.00042 52.9 17/46  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56194.1 GT:GENE ACF56194.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 420288..421928 GB:FROM 420288 GB:TO 421928 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF56194.1 GB:DB_XREF GI:194357746 LENGTH 546 SQ:AASEQ MFHEFGVVYTRPGRRHDFVPELRFEDFLDKQLSIDETASYYHRGVCIEGADSFENILDFIDWLPKIGMNSFFIQFENPYSFLKRWYEHEFNPYLNKEQFSNELVQELSDRLDKELQKRGLIHHRVGHGWTGEVLGYXSKFGWESGLSISEEKKPYVAEINGKRELFNTAPILTSLDFSNPDVADKMVEIIKDYAKKRPDVNYLHVWLSDARNNICECENCRQELVSDQYIRILNQLDRALTSEGLDTKICFXLYHELLWAPQKEKLDNPERFTMMFAPITRTFEMSYADVDFDNSIPTPKPYMRNKIILPNSLEENLSYLFEWQKAFKGDSFVYDYPLGRAHYGDLGYMKISQTIYRDVSYLSNLHLNGYISCQELRAGFPHNFPNYVMGEMLWKKTRSYEELIEEYFSALYGENWQSVVEYLEKLSIYSSCDYFNAIGSRQSDVLANHYYIAYNLADNFLPIIEENISKLLNSQKDEWKQLSYHREYVVKMAKALYLQATGKTRQAQDEWRNVLNYIRGHELLFQSNLDVYRVIEVAKNYAGFHL GT:EXON 1|1-546:0| BL:PDB:NREP 1 BL:PDB:REP 122->193|1vm6D|9e-04|33.8|65/217| RP:PDB:NREP 1 RP:PDB:REP 60->388|1cgwA|7e-05|11.0|326/686| HM:PFM:NREP 2 HM:PFM:REP 501->524|PF09303|0.00013|41.7|24/32|KcnmB2_inactiv| HM:PFM:REP 32->48|PF09145|0.00042|52.9|17/46|Ubiq-assoc| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111-1-1--------------11---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 376 STR:RPRED 68.9 SQ:SECSTR ##cTTccEEEccHHH########HccccGGGcccGGGccTTcccTTccccccHHHHHHHTTHHHHHTccEEEccccEEccccEEccTTcccEEEEEEEcTTTccHHHHHHHHHHHHHTTcTTEEEEccTTcTTcTTEEEEccTTccccccccccccccccTTTTTccccTTEEEccTTcHHHHHHHHHHHHHHHHTTccEcGGGccHHHHHHHHHHHHTTcccEEEEcccccTTcccHHHHHHcccEEccHHHHHHHHHHHTcccccHHHHHHHHHHHHHHHcTTGGGcEEccccTTccccccTTcc##HHHHHHHHHHHHTcccEETTTTTTcccccTTTTcccccccccccHHHHHHHHHTTHHHHcHHHHHcEEEEEEEcccEEE############################################################################################################################################################## PSIPRED ccccccEEEEccccccccccccccccccHHHccccccccEEEcEEEEccccHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccHHHccHHccccccccccccccccEEEEEcccEEEccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEEccccEEEcHHHHHHccccHHHHHHHHHHHHHHHcccccEEEHHHHHHHHccHHHHHcccHHHEEEEEEcccEEEEEEEEccccccccccccHHHcccccccccHHHHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHHHHHcccccEEEHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHHHHccHHHHcccccHHHHHHHHHHcccccc //