[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56195.1
DDBJ      :             segregation and condensation protein A
Swiss-Prot:SCPA_STRP4   RecName: Full=Segregation and condensation protein A;

Homologs  Archaea  0/68 : Bacteria  532/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.1.15
:242 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->116 1bhwA  c.1.15.3 * 7e-15 14.3 %
:RPS:SCOP  169->235 1w1wE  a.4.5.57 * 4e-08 27.3 %
:RPS:PFM   18->233 PF02616 * ScpA_ScpB 3e-24 37.1 %
:HMM:PFM   18->230 PF02616 * ScpA_ScpB 5.2e-32 29.9 211/242  
:BLT:SWISS 1->242 SCPA_STRP4 e-133 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56195.1 GT:GENE ACF56195.1 GT:PRODUCT segregation and condensation protein A GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1694946..1695674) GB:FROM 1694946 GB:TO 1695674 GB:DIRECTION - GB:PRODUCT segregation and condensation protein A GB:NOTE identified by match to protein family HMM PF02616 GB:PROTEIN_ID ACF56195.1 GB:DB_XREF GI:194357747 LENGTH 242 SQ:AASEQ MDIKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQLMLIKSRKLLPKVAEVTDLGDDLEQDLLSQIEEYRKFKLLGEHLEAKHQERAQYYSKAPTELIYEDAELVHDKTTIDLFLAFSNILAKKKEEFAQNHTTILRDEYKIEDMMIIVKESLIGRDQLRLQDLFKEAQNVQEIITLFLATLELIKTQELILVQEESFGDIYLMEKKEESQVPQS GT:EXON 1|1-242:0| SW:ID SCPA_STRP4 SW:DE RecName: Full=Segregation and condensation protein A; SW:GN Name=scpA; OrderedLocusNames=SPG_1761; SW:KW Cell cycle; Cell division; Chromosome partition; Complete proteome;Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->242|SCPA_STRP4|e-133|100.0|242/242| GO:SWS:NREP 4 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0007059|"GO:chromosome segregation"|Chromosome partition| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| RP:PFM:NREP 1 RP:PFM:REP 18->233|PF02616|3e-24|37.1|210/220|ScpA_ScpB| HM:PFM:NREP 1 HM:PFM:REP 18->230|PF02616|5.2e-32|29.9|211/242|ScpA_ScpB| RP:SCP:NREP 2 RP:SCP:REP 1->116|1bhwA|7e-15|14.3|112/392|c.1.15.3| RP:SCP:REP 169->235|1w1wE|4e-08|27.3|66/70|a.4.5.57| OP:NHOMO 534 OP:NHOMOORG 533 OP:PATTERN -------------------------------------------------------------------- 111-11-11111111--11-1111111111111111-111-----1-----11111-1------11-1--1-------1111-----------------------11-1---------------111111111-11111------1--------------------------------------------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1--11111111-11111---------1-1111111111111111111111------1--11--1111111111111111-11-111111111111111111----1------------------------------1-11-1111111111111111111111111111111111111111111111111111111111111111111111111-1-----------111111111111111---------------------------1111-111-111-1111111111111111111--11111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111------------------------11111111111111---1111111--------11-----1-111111-11111111111111-1111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 75-81,233-243| PSIPRED cEEEccccccHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccccccHHHHccccccHHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHccccEEHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEEccccccccc //