[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56199.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->29 PF08085 * Entericidin 5.5e-05 38.1 21/42  
:HMM:PFM   25->54 PF02214 * K_tetra 0.00039 23.3 30/94  
:BLT:SWISS 21->49 ALIB_STRR6 5e-04 41.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56199.1 GT:GENE ACF56199.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 302862..303035 GB:FROM 302862 GB:TO 303035 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56199.1 GB:DB_XREF GI:194357751 LENGTH 57 SQ:AASEQ MNIKKRVLSAGLTFASALLLAACGQSGSDTKTYSSTFSGNPTTFNYLLDYYADNTVN GT:EXON 1|1-57:0| BL:SWS:NREP 1 BL:SWS:REP 21->49|ALIB_STRR6|5e-04|41.4|29/652| HM:PFM:NREP 2 HM:PFM:REP 4->29|PF08085|5.5e-05|38.1|21/42|Entericidin| HM:PFM:REP 25->54|PF02214|0.00039|23.3|30/94|K_tetra| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,57-58| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccHHHHHHHHHHHHcccc //