[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56204.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.198.3
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   105->215 2kfpA PDBj 1e-21 41.4 %
:RPS:PDB   104->218 2a1vA PDBj 9e-23 21.9 %
:RPS:SCOP  104->218 2a1vA1  d.198.3.1 * 4e-21 21.0 %
:HMM:SCOP  98->218 2a1vA1 d.198.3.1 * 7.3e-29 33.3 %
:RPS:PFM   127->214 PF04237 * DUF419 2e-11 45.5 %
:HMM:PFM   113->215 PF04237 * DUF419 7.3e-21 34.5 87/92  
:BLT:SWISS 107->215 YYAQ_BACSU 6e-20 40.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56204.1 GT:GENE ACF56204.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1127919..1128575) GB:FROM 1127919 GB:TO 1128575 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF04237 GB:PROTEIN_ID ACF56204.1 GB:DB_XREF GI:194357756 LENGTH 218 SQ:AASEQ MFEIFKSYQFNQEKAHDYGFIENSEVWTYSCQILQGDFVMTVSITADNVNFQVFDQETGDLYPHVYMESMRGSFVGNVREACLEILYQIRKACFDVQDFICHQTKRIMTQVQEKYGNQLEYLWEKSPDTAVLRHEGNQKWYAVLMKISWNKLEKGREGQVEAVNLKHDQVANLLSQKGIYPAFHMSKRYWISVSLDDTLSDEEVLELIEKSWNLTSKK GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 107->215|YYAQ_BACSU|6e-20|40.4|109/118| BL:PDB:NREP 1 BL:PDB:REP 105->215|2kfpA|1e-21|41.4|111/125| RP:PDB:NREP 1 RP:PDB:REP 104->218|2a1vA|9e-23|21.9|105/138| RP:PFM:NREP 1 RP:PFM:REP 127->214|PF04237|2e-11|45.5|77/94|DUF419| HM:PFM:NREP 1 HM:PFM:REP 113->215|PF04237|7.3e-21|34.5|87/92|DUF419| RP:SCP:NREP 1 RP:SCP:REP 104->218|2a1vA1|4e-21|21.0|105/131|d.198.3.1| HM:SCP:REP 98->218|2a1vA1|7.3e-29|33.3|111/0|d.198.3.1|1/1|YjbR-like| OP:NHOMO 71 OP:NHOMOORG 70 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-------1------------------------------1--1--11---11-------------111111111111111111111111111111111111111-1111------------------------------1-----------------1-----------------------------------------------------------1---------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1-1---------------------------------------------------------------------1------------------------------------1---1--------------------------------------------------------111211-----------------------------------1--------------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 52.8 SQ:SECSTR #######################################################################################################HHHHHHHHTTcTTEEEEccccccEEEEEEEETTEEEEEEEEETTTccEEcccTTccccEEEEEccHHHHHHHHTTEEEcTTccTTTEEEEEccccccHHHHHHHHHHHHHHHHHH DISOP:02AL 218-219| PSIPRED ccHHHHcccccHHHHHHcccEEccccEEEEEEEEcccEEEEEEEEcccccEEEEEccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccEEEEEEccccEEEEEEEccccccccccccccEEEEEEcHHHHHHHHccccccccccccHHHEEEEEEcccccHHHHHHHHHHHHHHHccc //