[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56209.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  551/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:385 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->376 3k0bA PDBj e-100 51.9 %
:RPS:PDB   69->164 2dirA PDBj 2e-14 17.0 %
:RPS:SCOP  81->313 2ar0A1  c.66.1.45 * 4e-12 13.6 %
:HMM:SCOP  144->380 1o9gA_ c.66.1.29 * 1.7e-34 30.5 %
:RPS:PFM   168->353 PF01170 * UPF0020 1e-47 50.3 %
:HMM:PFM   167->372 PF01170 * UPF0020 1.9e-48 39.3 168/171  
:HMM:PFM   65->158 PF02926 * THUMP 0.00015 17.6 85/93  
:BLT:SWISS 3->385 YPSC_BACSU e-106 49.2 %
:PROS 304->310|PS00092|N6_MTASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56209.1 GT:GENE ACF56209.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 332035..333192 GB:FROM 332035 GB:TO 333192 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01170 GB:PROTEIN_ID ACF56209.1 GB:DB_XREF GI:194357761 LENGTH 385 SQ:AASEQ MKKKFNLIATVAAGLEAVVGREVRELGYDCQVENGRVRFQGDVRAIIETNLWLRAADRIKIIVGTFPAKTFEELFQGVFALDWENYLPLGARFPISKAKCVKSKLHNEPSVQAISKKAVVKKLQKHYARPEGVPLMENGPEFKIEVSILKDVATVMIDTTGSSLFKRGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAVMIARKMAPGLRRSFAFEEWNWISDRLIQEVRTEAAKKVDRELELDIMGCDIDARMVEIAKANAQAAGVAGDITFKQMRVQDLRSDKINGVIISNPPYGERLSDDAGVTKLYAEMGQVFAPLKTWSKFILTSDEAFESKYGSQADKKRKLYNGTLKVDLYQYFGQRVKRQEVK GT:EXON 1|1-385:0| BL:SWS:NREP 1 BL:SWS:REP 3->385|YPSC_BACSU|e-106|49.2|380/385| PROS 304->310|PS00092|N6_MTASE|PDOC00087| SEG 272->282|akanaqaagva| BL:PDB:NREP 1 BL:PDB:REP 3->376|3k0bA|e-100|51.9|362/374| RP:PDB:NREP 1 RP:PDB:REP 69->164|2dirA|2e-14|17.0|88/98| RP:PFM:NREP 1 RP:PFM:REP 168->353|PF01170|1e-47|50.3|185/193|UPF0020| HM:PFM:NREP 2 HM:PFM:REP 167->372|PF01170|1.9e-48|39.3|168/171|UPF0020| HM:PFM:REP 65->158|PF02926|0.00015|17.6|85/93|THUMP| RP:SCP:NREP 1 RP:SCP:REP 81->313|2ar0A1|4e-12|13.6|213/485|c.66.1.45| HM:SCP:REP 144->380|1o9gA_|1.7e-34|30.5|200/0|c.66.1.29|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 578 OP:NHOMOORG 568 OP:PATTERN -----------------------1-------1---11---------------------------11-- ------------------------------------------------------------------------------1-11------1111-111---111111111-1--------------1---------------------111-111--1111111111-1--11111111111111---------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-1111-11-1-1-1-1--------------------------------------------------------------1111-----11---------------------------------------------------11-1111111111111111111111111111111111111111111111111111111111111111111122211-11--1----11111112122222111---------------------------111111111111111111111111111111--1-1--1--11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111--1-111111--------1---------------------------1--11-1------ ------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------11--11-1-1--1--21-----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 374 STR:RPRED 97.1 SQ:SECSTR ##ccEEEEEEccTTHHHHHHHHTTTcTTEEEEccccEEEEcTTccHHHHHHHHHHHHHHHTTTccTTcHHHHHHHHHHHHHHHHHHcTcccEEEEcEEEccccccccHHHHHHHHHHHHHHHcHHHHHHHTTcEEccccccEEEEEEEETTEEEEEEEEcccTTHHHHHHTccccccccHHHHHHHHHHHcccTTccEEETTcTTTHHHHHHHHHHHTTTTTTcEEEEEEEcHHHHTTccHHHHGGGHHHHHHHHHTcEEEEEccHHHHHHHHHHHTTTccccGGGTccEEEccHHTcccEEEEEEccccTTccccccccccccccccHHHHHEEEEEEEEEEEEHHHHHccTHHHHHHHHHHHEEEEEEEEEEcc######### DISOP:02AL 1-1,376-386| PSIPRED cccEEEEEEEccccHHHHHHHHHHHcccEEEEEcccEEEEEcHHHHHHHHHHcccHHEEEEEEEccccccHHHHHHHHHcccHHHHcccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccEEEEEEEcccccccccccccccccccccHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHccccccccEEEEccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHcccccccEEEEEEccEEEEEEEEccccccccccc //