[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56210.1
DDBJ      :             Tn5253 CAAX amino terminal protease family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:PSIPRED
:HMM:PFM   106->192 PF02517 * Abi 3e-14 31.0 87/99  
:HMM:PFM   69->138 PF05884 * ZYG-11_interact 0.0007 20.0 70/299  
:HMM:PFM   6->38 PF10808 * DUF2542 0.00087 36.4 33/79  
:BLT:SWISS 106->171 CLS1_BACCR 7e-04 31.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56210.1 GT:GENE ACF56210.1 GT:PRODUCT Tn5253 CAAX amino terminal protease family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1254672..1255259) GB:FROM 1254672 GB:TO 1255259 GB:DIRECTION - GB:PRODUCT Tn5253 CAAX amino terminal protease family GB:NOTE identified by match to protein family HMM PF02517 GB:PROTEIN_ID ACF56210.1 GB:DB_XREF GI:194357762 LENGTH 195 SQ:AASEQ MKRIIPVYIFQQVNVLLVSLYLLKFLCIGELTILQILYSSSLISFLWMYGQRKQAHKVNMKSRMKWLGIGFVSLLIISLCFSLIHAQGTTNQANLIGLQHQVPWFSFLLFLINASMVEEFLYREILWNLVRKLDIRVALTSVLFALAHHPGTILAWCLYVSLGMFLGLVRYKSDLWGSMGLHLVWNLLVYSLLLF GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 106->171|CLS1_BACCR|7e-04|31.1|61/509| TM:NTM 7 TM:REGION 4->26| TM:REGION 28->49| TM:REGION 66->87| TM:REGION 101->123| TM:REGION 133->146| TM:REGION 152->170| TM:REGION 174->195| SEG 13->26|vnvllvslyllkfl| SEG 31->46|ltilqilyssslisfl| SEG 73->84|slliislcfsli| SEG 181->194|lhlvwnllvyslll| HM:PFM:NREP 3 HM:PFM:REP 106->192|PF02517|3e-14|31.0|87/99|Abi| HM:PFM:REP 69->138|PF05884|0.0007|20.0|70/299|ZYG-11_interact| HM:PFM:REP 6->38|PF10808|0.00087|36.4|33/79|DUF2542| OP:NHOMO 26 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---1---21122322-12--------------11---2-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //