[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56213.1
DDBJ      :             IS1381 transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->62 1h4rA PDBj 6e-04 32.1 %
:RPS:PDB   74->120 3e2pA PDBj 7e-06 25.5 %
:RPS:PFM   6->68 PF04326 * AAA_4 6e-12 58.6 %
:HMM:PFM   6->70 PF04326 * AAA_4 6.3e-13 26.7 60/122  
:BLT:SWISS 63->120 T702_FREDI 7e-05 38.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56213.1 GT:GENE ACF56213.1 GT:PRODUCT IS1381 transposase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1962689..1963054 GB:FROM 1962689 GB:TO 1963054 GB:DIRECTION + GB:PRODUCT IS1381 transposase GB:NOTE identified by match to protein family HMM PF04326 GB:PROTEIN_ID ACF56213.1 GB:DB_XREF GI:194357765 LENGTH 121 SQ:AASEQ MDLKFEGVDLEYKKAKNNLPESFWETYSAFANTNGGKIILGIDEKNIDTYQRVNRLPAKQNYEASKQLTDARFKRLVGVQRTTFKEMLAVLKTAYQLKHAKGGRKPKLSLEDLLMATLQYV GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 63->120|T702_FREDI|7e-05|38.6|57/276| BL:PDB:NREP 1 BL:PDB:REP 9->62|1h4rA|6e-04|32.1|53/294| RP:PDB:NREP 1 RP:PDB:REP 74->120|3e2pA|7e-06|25.5|47/306| RP:PFM:NREP 1 RP:PFM:REP 6->68|PF04326|6e-12|58.6|58/117|AAA_4| HM:PFM:NREP 1 HM:PFM:REP 6->70|PF04326|6.3e-13|26.7|60/122|AAA_4| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF04326|IPR007421| OP:NHOMO 98 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------11------------11----3-------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------------66--------563992H1686--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 82.6 SQ:SECSTR ########HHHHHHHHTTc#TTTTcEEEEEEETTccEEEEEEcccEEEEEcTTccccccEEE###########cccccGGGccHHHHHHHHHHHHHHHHHHHHcccccTTTTcEEEEEEc# DISOP:02AL 1-4,94-108| PSIPRED ccccccccEEEEEEHHHcccccHHHHHHHHHcccccEEEEEEEEccccEEEEEccccHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcc //