[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56214.1
DDBJ      :             translation elongation factor P
Swiss-Prot:EFP_STRZT    RecName: Full=Elongation factor P;         Short=EF-P;

Homologs  Archaea  0/68 : Bacteria  903/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
b.34.5b.40.4
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->186 1uebA PDBj 8e-32 40.3 %
:RPS:PDB   2->126 3cpfA PDBj 5e-27 14.9 %
:RPS:SCOP  1->63 1uebA1  b.34.5.2 * 6e-15 30.6 %
:RPS:SCOP  65->127 1bkbA2  b.40.4.5 * 1e-16 23.8 %
:RPS:SCOP  130->186 1uebA3  b.40.4.5 * 4e-12 52.6 %
:HMM:SCOP  1->64 1uebA1 b.34.5.2 * 9e-17 46.0 %
:HMM:SCOP  66->130 1iz6A2 b.40.4.5 * 2e-19 43.1 %
:HMM:SCOP  129->186 1uebA3 b.40.4.5 * 3.1e-18 58.6 %
:RPS:PFM   3->60 PF08207 * EFP_N 7e-09 42.1 %
:RPS:PFM   72->117 PF01132 * EFP 3e-06 41.3 %
:RPS:PFM   130->185 PF09285 * Elong-fact-P_C 4e-11 57.1 %
:HMM:PFM   130->185 PF09285 * Elong-fact-P_C 2e-27 58.9 56/56  
:HMM:PFM   4->61 PF08207 * EFP_N 5.6e-23 43.9 57/58  
:HMM:PFM   69->122 PF01132 * EFP 4.8e-19 35.2 54/55  
:BLT:SWISS 1->186 EFP_STRZT e-104 100.0 %
:PROS 151->170|PS01275|EFP

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56214.1 GT:GENE ACF56214.1 GT:PRODUCT translation elongation factor P GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(386713..387273) GB:FROM 386713 GB:TO 387273 GB:DIRECTION - GB:PRODUCT translation elongation factor P GB:NOTE identified by match to protein family HMM PF01132; match to protein family HMM PF08207; match to protein family HMM PF09285; match to protein family HMM TIGR00038 GB:PROTEIN_ID ACF56214.1 GB:DB_XREF GI:194357766 LENGTH 186 SQ:AASEQ MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATMETGLVVNVPDFIEAGQKLVINTAEGTYVSRA GT:EXON 1|1-186:0| SW:ID EFP_STRZT SW:DE RecName: Full=Elongation factor P; Short=EF-P; SW:GN Name=efp; OrderedLocusNames=SPT_0470; SW:KW Complete proteome; Cytoplasm; Elongation factor; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->186|EFP_STRZT|e-104|100.0|186/186| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003746|"GO:translation elongation factor activity"|Elongation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 151->170|PS01275|EFP|PDOC00981| BL:PDB:NREP 1 BL:PDB:REP 1->186|1uebA|8e-32|40.3|181/184| RP:PDB:NREP 1 RP:PDB:REP 2->126|3cpfA|5e-27|14.9|121/132| RP:PFM:NREP 3 RP:PFM:REP 3->60|PF08207|7e-09|42.1|57/58|EFP_N| RP:PFM:REP 72->117|PF01132|3e-06|41.3|46/55|EFP| RP:PFM:REP 130->185|PF09285|4e-11|57.1|56/56|Elong-fact-P_C| HM:PFM:NREP 3 HM:PFM:REP 130->185|PF09285|2e-27|58.9|56/56|Elong-fact-P_C| HM:PFM:REP 4->61|PF08207|5.6e-23|43.9|57/58|EFP_N| HM:PFM:REP 69->122|PF01132|4.8e-19|35.2|54/55|EFP| GO:PFM:NREP 2 GO:PFM GO:0003746|"GO:translation elongation factor activity"|PF01132|IPR001059| GO:PFM GO:0006414|"GO:translational elongation"|PF01132|IPR001059| RP:SCP:NREP 3 RP:SCP:REP 1->63|1uebA1|6e-15|30.6|62/63|b.34.5.2| RP:SCP:REP 65->127|1bkbA2|1e-16|23.8|63/65|b.40.4.5| RP:SCP:REP 130->186|1uebA3|4e-12|52.6|57/58|b.40.4.5| HM:SCP:REP 1->64|1uebA1|9e-17|46.0|63/0|b.34.5.2|1/1|Translation proteins SH3-like domain| HM:SCP:REP 66->130|1iz6A2|2e-19|43.1|65/0|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 129->186|1uebA3|3.1e-18|58.6|58/58|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1131 OP:NHOMOORG 930 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111221--1111111211112222222222222211111111111111112221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121222212221111232221111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111112111111111221111111111111111111111-1111111112111111111111111111111222221111111111111111111111111111111111111111111111111111111111111121111111111111111111111211111111111111111--11111111111111111111112111111111111222222222111111111111111111111111111111111111112222122212111111111111111211-1111111111122222222222222222-222222222222222122222222222222222222121222222222222112222222122221112111111111122121111111111111111111111111111111111-11111111111111111122222222222222222222222222222111111111-1111111111111111-11111111111111111111111111111111 ------------111----------------------------------------------------------------------------------------1----3------------------------------------------------------------------1112F-11122222-221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 100.0 SQ:SECSTR EEEGGGccTTcEEEEETTEEEEEEEEEEEccccEccEEEEEEEETTTccEEEEEEETTcEEEEEccEEEEEEEEEEETTEEEEETccEEcccccccHHHHHHHHHHHHHTcEEEEEETTEEEEEEEEcEEEEEEEEcccccccccccccEEEEEETTccEEEEETTccTTcEEEEETTTTEEEEEc DISOP:02AL 1-2,185-187| PSIPRED cccHHccccccEEEEEcccEEEEEEEEEEcccccccEEEEEEEEcccccEEEEEEccccEEEEEEEEEEEEEEEEEcccEEEEEEcccccEEEEcHHHHHHHHHHcccccEEEEEEEccEEEEEEcccEEEEEEEEcccccccccccccccEEEEEcccEEEcccccccccEEEEEcccccEEEcc //