[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56217.1
DDBJ      :             ABC transporter, ATP-binding/permease protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1f.37.1
:581 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   92->572 2hydA PDBj 5e-83 35.1 %
:RPS:PDB   3->570 3b60A PDBj 1e-64 27.3 %
:RPS:SCOP  3->319 2hydA2  f.37.1.1 * 4e-58 22.2 %
:RPS:SCOP  342->581 1q3hA  c.37.1.12 * 3e-37 23.9 %
:HMM:SCOP  6->320 1pf4A2 f.37.1.1 * 1.4e-73 32.4 %
:HMM:SCOP  342->555 1pf4A1 c.37.1.12 * 3.3e-60 36.9 %
:RPS:PFM   19->288 PF00664 * ABC_membrane 2e-29 31.2 %
:RPS:PFM   360->392 PF03193 * DUF258 4e-04 48.5 %
:RPS:PFM   375->500 PF00005 * ABC_tran 2e-09 35.8 %
:HMM:PFM   19->291 PF00664 * ABC_membrane 4.6e-40 24.7 271/275  
:HMM:PFM   375->497 PF00005 * ABC_tran 1.5e-19 31.5 111/118  
:HMM:PFM   336->392 PF03193 * DUF258 1.8e-07 37.5 56/161  
:BLT:SWISS 2->572 YHEI_BACSU e-139 43.6 %
:PROS 472->486|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56217.1 GT:GENE ACF56217.1 GT:PRODUCT ABC transporter, ATP-binding/permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1663849..1665594) GB:FROM 1663849 GB:TO 1665594 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding/permease protein GB:NOTE identified by match to protein family HMM PF00005; match to protein family HMM PF00664 GB:PROTEIN_ID ACF56217.1 GB:DB_XREF GI:194357769 LENGTH 581 SQ:AASEQ MSIIQKLWWFFKLEKRRYLVGIVALILVSVLNLIPPMVMGRVIDAITSGQLTQQDLLLSLFYLLLAAFGMYYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHATNDINALTRLAGGGVMSAVDASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGRKTHKAFGESQAAFSELNNKVQESVSGIKVTKSFGYQADELKSFQAVNELTFQKNLQTMKYDSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTFISYLDMLVWPLMAIGFLFNTTQRGKVSYQRIENLLSQESPVQDPEFPLDGIENGRLEYAIDSFAFENEETLTDIHFSLAKGQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIXLNGHDIRDYRLTDLRSLMGYVPQDQFLFATSILDNIRFGNPNLPLSAVVEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRLAMSRAMILEPDILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLILVLQNGQIIERGRHEDLLALDGWYAQTYQSQQLEMKGEEDAE GT:EXON 1|1-581:0| BL:SWS:NREP 1 BL:SWS:REP 2->572|YHEI_BACSU|e-139|43.6|571/585| PROS 472->486|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 5 TM:REGION 20->42| TM:REGION 49->71| TM:REGION 143->165| TM:REGION 244->266| TM:REGION 275->297| SEG 50->65|qltqqdlllslfylll| BL:PDB:NREP 1 BL:PDB:REP 92->572|2hydA|5e-83|35.1|479/578| RP:PDB:NREP 1 RP:PDB:REP 3->570|3b60A|1e-64|27.3|565/572| RP:PFM:NREP 3 RP:PFM:REP 19->288|PF00664|2e-29|31.2|266/274|ABC_membrane| RP:PFM:REP 360->392|PF03193|4e-04|48.5|33/160|DUF258| RP:PFM:REP 375->500|PF00005|2e-09|35.8|120/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 19->291|PF00664|4.6e-40|24.7|271/275|ABC_membrane| HM:PFM:REP 375->497|PF00005|1.5e-19|31.5|111/118|ABC_tran| HM:PFM:REP 336->392|PF03193|1.8e-07|37.5|56/161|DUF258| GO:PFM:NREP 9 GO:PFM GO:0005524|"GO:ATP binding"|PF00664|IPR001140| GO:PFM GO:0006810|"GO:transport"|PF00664|IPR001140| GO:PFM GO:0016021|"GO:integral to membrane"|PF00664|IPR001140| GO:PFM GO:0042626|"GO:ATPase activity, coupled to transmembrane movement of substances"|PF00664|IPR001140| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00664|IPR001140| GO:PFM GO:0003924|"GO:GTPase activity"|PF03193|IPR004881| GO:PFM GO:0005525|"GO:GTP binding"|PF03193|IPR004881| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 3->319|2hydA2|4e-58|22.2|316/323|f.37.1.1| RP:SCP:REP 342->581|1q3hA|3e-37|23.9|226/265|c.37.1.12| HM:SCP:REP 6->320|1pf4A2|1.4e-73|32.4|306/311|f.37.1.1|1/1|ABC transporter transmembrane region| HM:SCP:REP 342->555|1pf4A1|3.3e-60|36.9|214/244|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 40783 OP:NHOMOORG 1174 OP:PATTERN KJD4FBEFNMMKMJMIZDDB9DBQlKOXZKaKH6DBB9ECEA9NSOPcIP*va8JTIHRHIGD9K177 NPdC*RRTddcQWIPMLII-IQ88TwIIIIILWXYYk***GkMwYoiZhQNJlloGKYAAYeWSzWj***WTUTTkXVfM*aQB8DADRRMH4J8BJ--EDPKFIVMWMM43543438896666DRJENVIJRPVNUbbkmJIGwIgdgeVWcOQNPOEIGMFVWPdu**SGPFJEGENGIFBLHQBBif9VVq********t**********w****Qgo**hhwwwtuu**YbceefcYdcccbdbWYQTW*oVe**fNkYrurNO**bUQWhfcijmmqvrmuxwxsvtqomrxotqYbXWYZaadaaYY*ongfgpprmi*t*********f*hk***Wdda*jevwvhjME**ocQbceLQjZkiKYXNDPKKKLHJHFKUL***RMZxqo*hososrotkjp*-Yb*YUuYq**OA*************vFHKky*rmrw*xvPOPPPPPPZLQCIVQo665575557679679A79987877895A5ECCHBAj*tdvjqsquneedfbmm**mhljRkpm*lpyc6EZaYhOPVVhi*s**RVUDQFNYLEHFEHDGMMKNURTj*LYPbWKUhONZEXUROQUVOVGGLFdbShIDHLEFFGHIC787888898IHFDHIGceiKcKTFMInKRTUQJOPRPQPOVWURTS3-GFLGF322222*g*yPqdgonohmnnff-mgffigkiljnokddfedf*****gjdbfZcceeefecaeaca*aYaeedfM5rx*z***y*y*z33GDCFCCDLLOMHBtY*USTYUSEOQNKPKPbIKMKKDQEHNcWfgZiiul*dhnfeUuxyDDBBBECADHbhgvfgggfrtqqrIHNEIFEHHJBBBB64HQMLBCCE45434545*7XD9ABA-AAB9DD8GGEBBIBB8BBAQVlPKc*ghc9LI 6777uoO-kKC7XebLQRJNRWTjVlRKKEGFGUVQIQPOPLKFGFVQSfbelhSPWNNLKMLHJADC2JD7KFKEF2GJ9FEDKP7A-ZkFQRTRIHHMGAMbaQ6R*s*hqd*p*QLQNQfN**N*K**x2*a*SPQMoOU*kIUMOGjLH*QgZcsRw*Z*ZcU*gm*tk*eGNKF*CDCNL*np*L**JM****b ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 318-332,568-582| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEEccccHHcccccEEEEccccEEEEEccccccHHHHHHHHHHHccccccEEEEccEEHHHccHHHHHHHccEEccccccccccHHHHHHcccccccHHHHHHHHHHHccHHHHHHccHHHccccccccccccHHHHHHHHHHHHHHccccEEEEHHHHHHccHHHHHHHHHHHHHHHccccEEEEEccHHHHHcccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHHHHHHHHcccc //