[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56222.1
DDBJ      :             Ferritin-like domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  323/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->172 1umnI PDBj 6e-58 68.2 %
:RPS:PDB   24->167 2chpC PDBj 3e-27 26.6 %
:RPS:SCOP  22->166 2fjcA1  a.25.1.1 * 1e-39 36.6 %
:HMM:SCOP  24->167 1ji4A_ a.25.1.1 * 2e-39 34.7 %
:RPS:PFM   28->166 PF00210 * Ferritin 5e-11 34.6 %
:HMM:PFM   28->168 PF00210 * Ferritin 2.9e-25 23.4 137/142  
:BLT:SWISS 22->172 DPS_STRSU 2e-57 68.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56222.1 GT:GENE ACF56222.1 GT:PRODUCT Ferritin-like domain GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1443668..1444186) GB:FROM 1443668 GB:TO 1444186 GB:DIRECTION - GB:PRODUCT Ferritin-like domain GB:NOTE identified by match to protein family HMM PF00210 GB:PROTEIN_ID ACF56222.1 GB:DB_XREF GI:194357774 LENGTH 172 SQ:AASEQ MVELKKEAVKDVTSLTKAAPVALAKTKEVLNQAVADLYVAHVALHQVHWYMHGRGFLVWHPKMDEYMEALDGQLDEISERLITLGGSPFSTLTEFLQNSEIEEEAGEYRNVEESLERVLVIYRYLSELFQKGLDVTDEEGDDVTNGIFAGAKTETDKTIWMLAAELGQAPGL GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 22->172|DPS_STRSU|2e-57|68.2|151/172| BL:PDB:NREP 1 BL:PDB:REP 22->172|1umnI|6e-58|68.2|151/153| RP:PDB:NREP 1 RP:PDB:REP 24->167|2chpC|3e-27|26.6|143/145| RP:PFM:NREP 1 RP:PFM:REP 28->166|PF00210|5e-11|34.6|136/141|Ferritin| HM:PFM:NREP 1 HM:PFM:REP 28->168|PF00210|2.9e-25|23.4|137/142|Ferritin| GO:PFM:NREP 2 GO:PFM GO:0006879|"GO:cellular iron ion homeostasis"|PF00210|IPR008331| GO:PFM GO:0008199|"GO:ferric iron binding"|PF00210|IPR008331| RP:SCP:NREP 1 RP:SCP:REP 22->166|2fjcA1|1e-39|36.6|145/151|a.25.1.1| HM:SCP:REP 24->167|1ji4A_|2e-39|34.7|144/144|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 359 OP:NHOMOORG 323 OP:PATTERN -------------------------------------------------------------------- -1----11--1----11----1---1------1111-----------------------------1------------1---1-----111--211---112-11121-1---------------------------1111------111--111--------1--1111-------------111------12222222222222222112212222111111111111123111111111111111111112------21111111---11111111---1111111111111111111111111111111112111111---1---------------------1------------------------1--------------2111111--11------------------11----111------1---1----------1--11111111---11-1------------------------------------1--------------------------------------------------------------------------------------------------2---111--------111111111-1-----11-111-1-1---------------------------------1112-111111111111-1111111111111111111111-11-21111111111111111111111111-111111111111---1----------1-1--------11111111------1111---------------------------------1111112-11---------------------------------11-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 94.2 SQ:SECSTR ##########cccHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHcccccc DISOP:02AL 1-4,7-7,168-173| PSIPRED cccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //