[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56223.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:511 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   6->222 3dhwC PDBj 5e-27 34.1 %
:BLT:PDB   269->480 2yz2B PDBj 4e-16 32.5 %
:RPS:PDB   9->487 3cmvG PDBj 8e-58 12.9 %
:RPS:SCOP  5->222 1b0uA  c.37.1.12 * 8e-39 32.4 %
:RPS:SCOP  256->497 1ji0A  c.37.1.12 * 3e-27 23.8 %
:HMM:SCOP  9->222 1ii8.1 c.37.1.12 * 5.3e-60 38.2 %
:HMM:SCOP  255->493 1g6hA_ c.37.1.12 * 6.1e-43 31.6 %
:RPS:PFM   31->64 PF03193 * DUF258 5e-04 50.0 %
:RPS:PFM   46->171 PF00005 * ABC_tran 2e-12 39.3 %
:RPS:PFM   301->431 PF00005 * ABC_tran 2e-06 27.3 %
:HMM:PFM   46->171 PF00005 * ABC_tran 2.9e-23 36.8 117/118  
:HMM:PFM   301->431 PF00005 * ABC_tran 5.5e-12 25.2 115/118  
:HMM:PFM   23->63 PF03193 * DUF258 1.5e-06 32.5 40/161  
:HMM:PFM   148->213 PF00308 * Bac_DnaA 7e-05 27.3 66/219  
:BLT:SWISS 4->501 YUFO_BACSU e-180 63.9 %
:PROS 404->418|PS00211|ABC_TRANSPORTER_1
:REPEAT 2|4->240|256->501

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56223.1 GT:GENE ACF56223.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 742646..744181 GB:FROM 742646 GB:TO 744181 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF56223.1 GB:DB_XREF GI:194357775 LENGTH 511 SQ:AASEQ MAHENVIEMRDITKVFGGFVANDKINLHLRKGEIHALLGENGAGKSTLMNMLAGLLEPTSGEIAVNGQVVNLDSPSKAASLGIGMVHQHFMLVEAFTVAENIILGSELTKNGVLDIAGASKEIKALSERYGLAVDPSAKVADISVGAQQRVEILKTLYRGADILIFDEPTAVLTPSEIDELMAIMKNLVKEGKSIILITHKLDEIRAVSDRVTVIRCGKSIETVEIAGATNADLAEMMVGRSVSFKTEKQASKPKEVVLSIKDLVVNENRGVPAVKNLSLDVRAGEIVGIAGIDGNGQXELIQAITGXXKVESGSIELKGDSIVGLHPRQITELSVGHVPEDRHRDGLILEMMISENIALQTYYKEPHSKNGILNYSNITSYAKKLMEEFDVRAASELVPAAALSGGNQQKAIIAREIDRDPDLLIVSQPTRGLDVGAIEYIHKRLIEERDNGKAVLVVSFELDEILNVSDRIAVIHDGKIQGIVSPETTNKQGLGVLMAGGNLGKEKSDV GT:EXON 1|1-511:0| BL:SWS:NREP 1 BL:SWS:REP 4->501|YUFO_BACSU|e-180|63.9|498/510| PROS 404->418|PS00211|ABC_TRANSPORTER_1|PDOC00185| NREPEAT 1 REPEAT 2|4->240|256->501| BL:PDB:NREP 2 BL:PDB:REP 6->222|3dhwC|5e-27|34.1|214/343| BL:PDB:REP 269->480|2yz2B|4e-16|32.5|194/263| RP:PDB:NREP 1 RP:PDB:REP 9->487|3cmvG|8e-58|12.9|459/1167| RP:PFM:NREP 3 RP:PFM:REP 31->64|PF03193|5e-04|50.0|34/160|DUF258| RP:PFM:REP 46->171|PF00005|2e-12|39.3|122/123|ABC_tran| RP:PFM:REP 301->431|PF00005|2e-06|27.3|112/123|ABC_tran| HM:PFM:NREP 4 HM:PFM:REP 46->171|PF00005|2.9e-23|36.8|117/118|ABC_tran| HM:PFM:REP 301->431|PF00005|5.5e-12|25.2|115/118|ABC_tran| HM:PFM:REP 23->63|PF03193|1.5e-06|32.5|40/161|DUF258| HM:PFM:REP 148->213|PF00308|7e-05|27.3|66/219|Bac_DnaA| GO:PFM:NREP 6 GO:PFM GO:0003924|"GO:GTPase activity"|PF03193|IPR004881| GO:PFM GO:0005525|"GO:GTP binding"|PF03193|IPR004881| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 5->222|1b0uA|8e-39|32.4|216/258|c.37.1.12| RP:SCP:REP 256->497|1ji0A|3e-27|23.8|230/240|c.37.1.12| HM:SCP:REP 9->222|1ii8.1|5.3e-60|38.2|212/370|c.37.1.12|1/2|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 255->493|1g6hA_|6.1e-43|31.6|234/254|c.37.1.12|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 49012 OP:NHOMOORG 1172 OP:PATTERN QPI9PLHKUUURUPWNjHTQMRQa*PTgnUgYKEDEECIGHECRZOXhKQ**f9NZORTMNKLDX18B PYuP*ddcoosaYKWQRMM-Mc88U*MMMMMKokklw***V*U*s*viqigK***QRjFFsy*h*o****gdYYY*dZbN*ikAAA8CTSTO4NGJK--IHUONMbNcPX666666688A9999IURJRXNLXSaSkrrz*KJJ*YjjpyhfhZdRTMGNJLGdbbk***ZJTHIHGHRILHHkcfUPhe8Ygz************************ipy**ksxxxuty**alnnmnklllmmllkYbWfb*gac**dRcYjxwRS**fYTciiikmqotxupzz**uwssnntyotscbbaZcceeccaa*rredfutwmp***********j*mv***ellj*vivy*juTK**sjYdjnTcjcopRZcbLdXVVLJMLJNba***ZQw****************-ms*jf*p***RB**************KKO**********POPPPPPPzafJSpY*776687775557BADFACBAC9CCA7394KECECE************************q********BS**y*ozpv******dpnJZKQhYHIJHJIHVRTapoX**UdT*lXiybZnLfbaWSbiQZdgZew*Z*ILKQGJJJLGGACCCCCDDCGPDHJMLmktQpXZLVOzUWacXOWfXUVWWVdbZZY5-DMTPM31-222****Y*yx***y*z*uw-*xwx*u*y*z***tuwutv*****lqgqrnopsqqqqpoqoon*tomsssvU3************23JHEHEEFOQQPPM*h*XXYYZUHORMMUOSdPRSQRIVIPUnbxvwtw***x***xj***IGHFGIIGGOipp*uvvvv*****QPQKLLKKMMEDED56NSTTOPMM89888888*DXB99AD-BCA8CCBMOL8AIBGD558coqSVk*kqfCgO 2212fTC-XG7BPcIEAD98EJDLBKDCC8979HFI6D9A9AA788BBEKHGOI9EE9BA9886655634735986738665355646-9C8AB9B868685CJD92FSdjUYTlbaKGEDHYKqi9*D**l2rUmLKG9gCMnaBOEFFfDC*FYSSxFe*LmNc9*Ua*cbRNDDFA*BB9FGtWd*B*u9FvdlkE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,503-512| PSIPRED cccccEEEEEEEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccEEEEccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEEcHHHccHHHHHHHHcccccccHHcccccccccccccccccEEccccccEEEEcccEEEccccEEEEEEcccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccEEcccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccccHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEEcHHHccHHHHHHHHccccHHHHcccc //