[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56227.1
DDBJ      :             PTS system,  IIB component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  121/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.44.2
:93 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->93 3czcA PDBj 9e-29 73.0 %
:RPS:PDB   1->93 3czcA PDBj 2e-14 67.4 %
:RPS:SCOP  1->93 1vkrA  c.44.2.1 * 1e-16 20.0 %
:HMM:SCOP  1->93 1vkrA_ c.44.2.1 * 3.9e-18 32.2 %
:HMM:PFM   3->89 PF02302 * PTS_IIB 1e-16 22.1 86/90  
:BLT:SWISS 4->92 ULAB_MYCPN 1e-18 45.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56227.1 GT:GENE ACF56227.1 GT:PRODUCT PTS system, IIB component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1852935..1853216) GB:FROM 1852935 GB:TO 1853216 GB:DIRECTION - GB:PRODUCT PTS system, IIB component GB:NOTE identified by match to protein family HMM PF02302 GB:PROTEIN_ID ACF56227.1 GB:DB_XREF GI:194357779 LENGTH 93 SQ:AASEQ MVKVLAACGNGMGSSMVIKMKVENALRKLNQTDFTVNSCSVGEAKGLAVGYDIVIASLHLIQELEGRTNGKLIGLDNLMDDKEITEKLSQALQ GT:EXON 1|1-93:0| BL:SWS:NREP 1 BL:SWS:REP 4->92|ULAB_MYCPN|1e-18|45.5|88/95| BL:PDB:NREP 1 BL:PDB:REP 1->93|3czcA|9e-29|73.0|89/89| RP:PDB:NREP 1 RP:PDB:REP 1->93|3czcA|2e-14|67.4|89/89| HM:PFM:NREP 1 HM:PFM:REP 3->89|PF02302|1e-16|22.1|86/90|PTS_IIB| RP:SCP:NREP 1 RP:SCP:REP 1->93|1vkrA|1e-16|20.0|90/97|c.44.2.1| HM:SCP:REP 1->93|1vkrA_|3.9e-18|32.2|90/0|c.44.2.1|1/1|PTS system, Lactose/Cellobiose specific IIB subunit| OP:NHOMO 121 OP:NHOMOORG 121 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1------------------------------------111111----------------------1-------------------------1111111-11111111111111111111111111111---1111------------1-1----1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111111--1-1111111111111111111111--1-11111-11111111-11-1111111--1---------------------------------------------------------------------------------------------1--------------------------------------------1--11--111--1111---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 97.8 SQ:SECSTR cEEEEEEccccHHHHHH##HHHHHHHHHTTcccEEEEEEcHHHHHHHGGGccEEEEETTTGGGTTTccccEEEEEccTcHHHHHHHHHHHHHc PSIPRED cEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEEHHHcccccccccEEEEEHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcc //