[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56235.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:CBIO2_STRR6  RecName: Full=Cobalt import ATP-binding protein cbiO 2;         EC=3.6.3.-;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:275 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->233 3gfoA PDBj 3e-38 36.8 %
:RPS:PDB   4->229 3b5jA PDBj 4e-48 34.1 %
:RPS:SCOP  3->230 1b0uA  c.37.1.12 * 6e-44 29.9 %
:HMM:SCOP  7->218 1ii8.1 c.37.1.12 * 1.7e-64 39.3 %
:RPS:PFM   47->169 PF00005 * ABC_tran 3e-21 46.2 %
:HMM:PFM   47->169 PF00005 * ABC_tran 2.4e-25 35.7 115/118  
:HMM:PFM   231->271 PF12370 * CoABC_C 3e-11 41.5 41/46  
:HMM:PFM   17->65 PF03193 * DUF258 0.00016 20.8 48/161  
:BLT:SWISS 1->275 CBIO2_STRR6 e-154 99.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56235.1 GT:GENE ACF56235.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2057631..2058458) GB:FROM 2057631 GB:TO 2058458 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF56235.1 GB:DB_XREF GI:194357787 LENGTH 275 SQ:AASEQ MKSIIDVKNLSFRYKENQNYYDVKDITFHVKRGEWLSIVGHNGSGKSTTVRLIDGLLEAESGEIVIDGQRLTEENVWNIRRQIGMVFQNPDNQFVGATVEDDVAFGLENQGLSRQEMKKRVEEALALVGMLDFKKREPARXSGGQKQRVAIAGVVALRPAILILDEATSMLDPEGRRELIGTVKGIRKDYDMTVISITHDLEEVAMSDRVLVMKKGEIESTSSPRELFSRNDLDQIGLDDPXANQLKKSLSQNGYDLPENYLTESELEDKLWELL GT:EXON 1|1-275:0| SW:ID CBIO2_STRR6 SW:DE RecName: Full=Cobalt import ATP-binding protein cbiO 2; EC=3.6.3.-; SW:GN Name=cbiO2; Synonyms=stpA; OrderedLocusNames=spr2026; SW:KW ATP-binding; Cell membrane; Cobalt; Cobalt transport;Complete proteome; Hydrolase; Ion transport; Membrane;Nucleotide-binding; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->275|CBIO2_STRR6|e-154|99.3|275/275| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006824|"GO:cobalt ion transport"|Cobalt transport| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 4->233|3gfoA|3e-38|36.8|228/251| RP:PDB:NREP 1 RP:PDB:REP 4->229|3b5jA|4e-48|34.1|223/243| RP:PFM:NREP 1 RP:PFM:REP 47->169|PF00005|3e-21|46.2|119/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 47->169|PF00005|2.4e-25|35.7|115/118|ABC_tran| HM:PFM:REP 231->271|PF12370|3e-11|41.5|41/46|CoABC_C| HM:PFM:REP 17->65|PF03193|0.00016|20.8|48/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->230|1b0uA|6e-44|29.9|224/258|c.37.1.12| HM:SCP:REP 7->218|1ii8.1|1.7e-64|39.3|206/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 54941 OP:NHOMOORG 1174 OP:PATTERN VVNBTMNLaZZVZVcQpKRTNRNZxPTlpWkUJCFFGDIHIGFVbVZoNR**l8UhTUWNWLLGc1AC Zd*P*ijmyy*bjXbYZRQ-QlBBb*RRRRRRtsttx***X*Y*y**j*ogU***TXjFF***p*u****hfeee*hggQ*ltCBEACWWTM7QHLM--IGWNMNkPeQUABAAAABCDDCCCCKWTNUbQPXZcTouu**LKK*a*sv*qppilZbTMSPQNjmaq***eOVLRNPNUMSMNmcfUSwpDcj*************************ks***rt********bopqqqnlopooooocideh*kdi**kSjaoyxQQ**faScpqmknvw**zw****w*xwury*uwwijihhjklmlkhi*stjjksruos***********k*q****fqpm*zo***syVM***padkoSbogtrQhghOfWYYRNQOLSjb***dXy****************-rx*mj*t***VE**************ONN**********VUVVVVVVzXcLUnb*666677776579ABDE9CCCABBBC86A6JFEGEF************************o********AQ**x*pysx******gtqRXMVpcKMLKMKLVTTfupf**VmYzqWr*ecqLiedYXcnZfXXVZw*b*ONPUJOOOQNJCBEEEEEEELWIINTSyv*UxWiOYN*TbbdaQXgYXXZacebbff5-FLZRP321544****b************-************************wxpzyuzy*y**zwx*xzw**w*****X5************44NKEHEEFOPRPSJ*o*cbcddaKSVRPZQViPRTSRIWHQUtf*************o***HHGFFHHFHNktr*vwwww*****SSTOQPOOQRGEFE87OWXXNOOOAA898999*CeFDDEF-HFGCNHEPONDIQFHJBBCgm*bcv*vtuFjQ 4244jdO-mOCGZlVKKQHGOQOZOWOIIDFDFRPOELIKHIIDDCKHLVRQcSIHPIIGFGGAD89837E5DCE8A27A8A98AB59-SZEKIMLDBEICAIPLE5Nir*XkYwfsOHKJMbOxxI*G**t4*W*NPNIpMO*dKTNHFiGE*LeWXzLl*RwXXH*cn*pnwcGMIF*IHENH*im*I**KN*ftsL ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-1,138-143| PSIPRED cccEEEEEEEEEEccccccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEccccccHHHHcccEEEEEcHHHccccccHHHHccccHHHccccHHHHHHHHHHHHHHcccHHHHccccccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEcccHHHHHHccEEEEEEccEEEEEccHHHHHHcccccHHHcccccHHHHHHHHHHccEEcccccccHHHHHHHHHHHc //