[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56245.1
DDBJ      :             aminopeptidase C
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  99/915 : Eukaryota  125/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:444 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->443 1cb5A PDBj 1e-89 43.0 %
:RPS:PDB   8->443 1cb5A PDBj 1e-52 39.4 %
:RPS:SCOP  292->444 1a6rA  d.3.1.1 * 5e-19 29.4 %
:HMM:SCOP  1->443 3gcbA_ d.3.1.1 * 2.9e-137 41.2 %
:RPS:PFM   15->439 PF03051 * Peptidase_C1_2 e-148 59.6 %
:HMM:PFM   4->440 PF03051 * Peptidase_C1_2 2.3e-210 60.0 437/438  
:BLT:SWISS 1->443 PEPC_STRTR 0.0 77.4 %
:PROS 63->74|PS00139|THIOL_PROTEASE_CYS
:PROS 361->371|PS00639|THIOL_PROTEASE_HIS
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56245.1 GT:GENE ACF56245.1 GT:PRODUCT aminopeptidase C GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 256166..257500 GB:FROM 256166 GB:TO 257500 GB:DIRECTION + GB:PRODUCT aminopeptidase C GB:NOTE identified by match to protein family HMM PF03051 GB:PROTEIN_ID ACF56245.1 GB:DB_XREF GI:194357797 LENGTH 444 SQ:AASEQ MNAIQESFTDKLFANYEANVKYQAIENAASHNGIFAALECRQSHVDNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLISQYKLENFELSQAHTFFWDKYEKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDMVVSLFEKYGVVPKSVYPESVSSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKKEDLLQEIFNFLAMSLGLPPRKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVINAPTADKPYGKSYTVEMLGNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQLSNRKAGILATDVYDFESSMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKVENSWGDKVGTDGYFVASDAWMDEYTYQIVVRKELLTAEEQAAYGAEPIVLAPWDPMGALAE GT:EXON 1|1-444:0| BL:SWS:NREP 1 BL:SWS:REP 1->443|PEPC_STRTR|0.0|77.4|443/445| PROS 63->74|PS00139|THIOL_PROTEASE_CYS|PDOC00126| PROS 361->371|PS00639|THIOL_PROTEASE_HIS|PDOC00126| SEG 153->168|vvpksvypesvsssss| BL:PDB:NREP 1 BL:PDB:REP 60->443|1cb5A|1e-89|43.0|384/453| RP:PDB:NREP 1 RP:PDB:REP 8->443|1cb5A|1e-52|39.4|432/453| RP:PFM:NREP 1 RP:PFM:REP 15->439|PF03051|e-148|59.6|423/435|Peptidase_C1_2| HM:PFM:NREP 1 HM:PFM:REP 4->440|PF03051|2.3e-210|60.0|437/438|Peptidase_C1_2| GO:PFM:NREP 2 GO:PFM GO:0004197|"GO:cysteine-type endopeptidase activity"|PF03051|IPR004134| GO:PFM GO:0006508|"GO:proteolysis"|PF03051|IPR004134| RP:SCP:NREP 1 RP:SCP:REP 292->444|1a6rA|5e-19|29.4|153/459|d.3.1.1| HM:SCP:REP 1->443|3gcbA_|2.9e-137|41.2|439/458|d.3.1.1|1/1|Cysteine proteinases| OP:NHOMO 295 OP:NHOMOORG 224 OP:PATTERN -------------------------------------------------------------------- ------------2--------------------------------------------1-------------22222222---------1111-111---------------------------------------------------------------------------------------------------------------------------------111111----------------------14232231446222222211-1211111111111111111111111111111111111111111111111--------------------------1---1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1--12------2------------------- ------1--------11111---1111111111111-------11111111111111--11122-1--1-111-1-1-12111111---1311112---1211211-1--1121311111111111111281-11411111111111111111111111------134124--11--------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 437 STR:RPRED 98.4 SQ:SECSTR #######HHHHHTTcHHHHHHHHHHHHHHTTccHHHHHccHHHHHHccccccEEcccccccccccccTHHHHHHHHHHHHHHHHHHTcccccccHHHHHHHHHHHHHHHHHHHHHHHHHTcTTcHHHHHHHHcTTcccccHHHHHHHHHHHccccGGGccccTGGGccHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcTTccEEEEEEEcHHHHHHHHTTTTGGGEEEEEccccTTccccEEEEETTccccTTccccEEEEccHHHHHHHHHHHHHTTccEEEEEcTTTTEETTTTEEcTTcccHHHHHcccccccHHHHHHTTcccccEEEEEEEEEEcTTccEEEEEEEccccTTcTcTTEEEEEHHHHHHHEEEEEEEGGGccHHHHGGGGcccEEEcTTcGGGcccc DISOP:02AL 1-1,444-445| PSIPRED cccccHHHHHHHHHHHHHcHHHHHHHHHHHHccHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccccEEccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHccccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccHHHHHHHHccccHHHEEEEEEccccccccccEEEEEEcccccccccEEEccccHHHHHHHHHHHHHccccEEEEcccccccccccccHHHHHHcHHHcccccccccHHHHHcccccccccEEEEEEEEEcccccEEEEEEEEccccccccccEEEEEHHHHHHHHHEEEEEHHHccHHHHHHHccccEEcccccccHHHcc //