[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56249.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->70 PF07666 * MpPF26 9.5e-06 36.1 61/130  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56249.1 GT:GENE ACF56249.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 613836..614063 GB:FROM 613836 GB:TO 614063 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56249.1 GB:DB_XREF GI:194357801 LENGTH 75 SQ:AASEQ MKEKKKNPLFVGILSIILGLLFPIVGLILGIIGLVLAISYQKESQLDYKIEKILNILGIVISVVNWIVAIALIFR GT:EXON 1|1-75:0| TM:NTM 2 TM:REGION 13->35| TM:REGION 50->72| SEG 16->38|iilgllfpivglilgiiglvlai| HM:PFM:NREP 1 HM:PFM:REP 9->70|PF07666|9.5e-06|36.1|61/130|MpPF26| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //