[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56257.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->65 2csfA PDBj 2e-09 12.3 %
:RPS:SCOP  1->64 2aw6A1  a.35.1.11 * 3e-08 21.0 %
:HMM:SCOP  2->64 2awiA1 a.35.1.11 * 2.7e-09 36.1 %
:HMM:PFM   8->59 PF01381 * HTH_3 6.1e-10 39.2 51/55  
:BLT:SWISS 4->64 CEBA_BACAM 8e-04 29.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56257.1 GT:GENE ACF56257.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1913557..1913937) GB:FROM 1913557 GB:TO 1913937 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56257.1 GB:DB_XREF GI:194357809 LENGTH 126 SQ:AASEQ MREFGEKIKRLRLAKKISRSEFCGDESELSIRQLIRIENGESRPTLTKLKYIAERLGVEDYKLMPSYIELDKEYLELKYFLMRTPTYEDETIAQKKESVLIRFLKSIMIGYLRKKDLSSQIIHIWH GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 4->64|CEBA_BACAM|8e-04|29.5|61/100| RP:PDB:NREP 1 RP:PDB:REP 1->65|2csfA|2e-09|12.3|65/101| HM:PFM:NREP 1 HM:PFM:REP 8->59|PF01381|6.1e-10|39.2|51/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 1->64|2aw6A1|3e-08|21.0|62/69|a.35.1.11| HM:SCP:REP 2->64|2awiA1|2.7e-09|36.1|61/0|a.35.1.11|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 57 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11112-2222222222221311111111111111-111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 100.0 SQ:SECSTR cTHHHHHHHHHHHHHTccHHHHHHHHTcccHHHHHHHHHHcccccTTcHHHHHHHHHHHHHHTccHHHHHHHHHTcHHHHHHccccHHHHcccccccHTTccTTcHHHHHHHHHHHHHHHHTTccc DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHc //