[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56266.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->43 PF12408 * DUF3666 9.6e-05 30.0 20/48  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56266.1 GT:GENE ACF56266.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1575523..1575720) GB:FROM 1575523 GB:TO 1575720 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56266.1 GB:DB_XREF GI:194357818 LENGTH 65 SQ:AASEQ MQALYVKKEKKLSNDYHKINTGNQSNFYENVKDNEIKDFLTKVSNLFFKKFLMKQSKTINLKLAH GT:EXON 1|1-65:0| HM:PFM:NREP 1 HM:PFM:REP 24->43|PF12408|9.6e-05|30.0|20/48|DUF3666| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111--11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,6-7,65-66| PSIPRED cccEEEHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcc //