[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56267.1
DDBJ      :             ABC transporter,  permease protein, point mutation
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  161/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:95 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->94 2r6gG1  f.58.1.1 * 4e-09 8.5 %
:HMM:PFM   2->90 PF00528 * BPD_transp_1 1.1e-07 11.9 84/185  
:BLT:SWISS 10->93 YHDY_ECOLI 8e-09 32.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56267.1 GT:GENE ACF56267.1 GT:PRODUCT ABC transporter, permease protein, point mutation GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(631094..631381) GB:FROM 631094 GB:TO 631381 GB:DIRECTION - GB:PRODUCT ABC transporter, permease protein, point mutation GB:PROTEIN_ID ACF56267.1 GB:DB_XREF GI:194357819 LENGTH 95 SQ:AASEQ MTNVQLYYHIIIPQVLRRLLPQAINLVTRMIKTTSLVVLIGVVEVTKVGQQIIDSNRLTIPTASFWIYGTILILYFAVCYPISKLSTHLEKHWRN GT:EXON 1|1-95:0| BL:SWS:NREP 1 BL:SWS:REP 10->93|YHDY_ECOLI|8e-09|32.1|81/367| TM:NTM 2 TM:REGION 19->41| TM:REGION 58->80| HM:PFM:NREP 1 HM:PFM:REP 2->90|PF00528|1.1e-07|11.9|84/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 1->94|2r6gG1|4e-09|8.5|94/284|f.58.1.1| OP:NHOMO 216 OP:NHOMOORG 165 OP:PATTERN ----------------1----------------------111-------------------------- -----------------------------------------------------------------------11111111-------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------12-11-11112-------1--------------1--11111-1121-----------------222------1-1------------------1---------11---1----------1--------------2--------------------1---3--1--1---2441222222-252-----21--1--1---------11--------------------------------------------1-2212-1-------2------1111-1---11-1----213131-1-------11-------------1--3-2-122221------------------11--11111-111111111-------11--------1----------------------------------21--1------------------------------11111-------------------1----------11111111111-----------------11111-1---------11111-1---------11121-2---312-----------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,95-96| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //