[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56271.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->124 PF11683 * DUF3278 1e-29 57.9 %
:HMM:PFM   1->126 PF11683 * DUF3278 1.7e-51 54.0 126/129  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56271.1 GT:GENE ACF56271.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(290437..290979) GB:FROM 290437 GB:TO 290979 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56271.1 GB:DB_XREF GI:194357823 LENGTH 180 SQ:AASEQ MKKETFTEKLIKRTYGISDPLDEYKRREADSIGNQVFIVLFYLMIFGNIIPLLLAYKYPQEVALIYPPLILVIALIASGYVTYQMKKTGITVIEPDMLNEKESKQLHYPGLKAGLFFGLWMFFITPLLSILIDEGQDYFHSLLTIRNGVSSILGSIFFGASIQFLISRRIAKTKKNQDED GT:EXON 1|1-180:0| TM:NTM 4 TM:REGION 32->54| TM:REGION 61->83| TM:REGION 111->133| TM:REGION 146->167| RP:PFM:NREP 1 RP:PFM:REP 4->124|PF11683|1e-29|57.9|121/127|DUF3278| HM:PFM:NREP 1 HM:PFM:REP 1->126|PF11683|1.7e-51|54.0|126/129|DUF3278| OP:NHOMO 26 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11------------------1--11112221112-------------211---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,169-181| PSIPRED ccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEcHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //