[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56276.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y802_STRZT   RecName: Full=UPF0291 protein SPT_0802;

Homologs  Archaea  0/68 : Bacteria  123/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.21
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->45 2jvdA PDBj 8e-10 58.5 %
:RPS:PDB   1->52 3bhpC PDBj 3e-10 46.2 %
:RPS:SCOP  1->41 2hepA1  a.2.21.1 * 9e-08 58.5 %
:RPS:PFM   6->66 PF05979 * DUF896 7e-10 68.9 %
:HMM:PFM   4->67 PF05979 * DUF896 6.4e-34 62.5 64/65  
:BLT:SWISS 1->85 Y802_STRZT 7e-46 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56276.1 GT:GENE ACF56276.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1355242..1355499) GB:FROM 1355242 GB:TO 1355499 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56276.1 GB:DB_XREF GI:194357828 LENGTH 85 SQ:AASEQ MDPKKIARINELAKKKKTEGLTPEEKVEQAKLREEYIEGYRRAVRHHIEGIKIVDEEGNDVTPEKLRQVQREKGLHGRSLDDPNS GT:EXON 1|1-85:0| SW:ID Y802_STRZT SW:DE RecName: Full=UPF0291 protein SPT_0802; SW:GN OrderedLocusNames=SPT_0802; SW:KW Complete proteome; Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->85|Y802_STRZT|7e-46|100.0|85/85| GO:SWS:NREP 1 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| BL:PDB:NREP 1 BL:PDB:REP 5->45|2jvdA|8e-10|58.5|41/48| RP:PDB:NREP 1 RP:PDB:REP 1->52|3bhpC|3e-10|46.2|52/52| RP:PFM:NREP 1 RP:PFM:REP 6->66|PF05979|7e-10|68.9|61/65|DUF896| HM:PFM:NREP 1 HM:PFM:REP 4->67|PF05979|6.4e-34|62.5|64/65|DUF896| RP:SCP:NREP 1 RP:SCP:REP 1->41|2hepA1|9e-08|58.5|41/42|a.2.21.1| OP:NHOMO 162 OP:NHOMOORG 123 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1122222222-2222221111112221111111222222-2122222222222221111122-111111111--1111111--1-1-11111111111111111111111111111111111111111111-----------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 61.2 SQ:SECSTR ccHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHTTHHHHTTccTTTc################################# DISOP:02AL 1-2,20-25,69-86| PSIPRED ccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccccccHHHHHHHHHHHcccccccccccc //